Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00060602-protein ID=TCONS_00060602-protein|Name=TCONS_00060602-protein|organism=Clytia hemisphaerica|type=polypeptide|length=101bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00060602-protein vs. Swiss-Prot (Human)
Match: HSBP1 (Heat shock factor-binding protein 1 OS=Homo sapiens GN=HSBP1 PE=1 SV=1) HSP 1 Score: 87.0409 bits (214), Expect = 3.529e-24 Identity = 41/60 (68.33%), Postives = 48/60 (80.00%), Query Frame = 0 Query: 21 TEPKNVQDLTVFVENLLSTMQDKFQAMSDQILTRMDDMGGRIDELEKNIGDLMQQAGIED 80 T+PK VQDLT V+ LL MQDKFQ MSDQI+ R+DDM RID+LEKNI DLM QAG+E+ Sbjct: 4 TDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEE 63 The following BLAST results are available for this feature:
BLAST of TCONS_00060602-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|