Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00060367-protein ID=TCONS_00060367-protein|Name=TCONS_00060367-protein|organism=Clytia hemisphaerica|type=polypeptide|length=114bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00060367-protein vs. Swiss-Prot (Human)
Match: RB11A (Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3) HSP 1 Score: 88.9669 bits (219), Expect = 3.308e-23 Identity = 42/64 (65.62%), Postives = 51/64 (79.69%), Query Frame = 0 Query: 35 TMTDFHDYFYKIVLIGDSAVGKSCLLSRFTYNEFNSESKSTIGVDFATKSVIIDDKVVKVQVCW 98 T D +DY +K+VLIGDS VGKS LLSRFT NEFN ESKSTIGV+FAT+S+ +D K +K Q+ W Sbjct: 3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQI-W 65 The following BLAST results are available for this feature:
BLAST of TCONS_00060367-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|