|
|
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00057567-protein ID=TCONS_00057567-protein|Name=TCONS_00057567-protein|organism=Clytia hemisphaerica|type=polypeptide|length=215bp
MRIKSVKTDRHINVEDDDSDTSSTISNNDVDVKEALRSSISLNLKSKFQK
GDYPPTLHNSLTSSSTSSTSAPYLYRPHLDLLDKPARQDDEMSHVSTDSI
DIGTPASMAAAPGKKEKKPKKPEDKETAAMRRERNRLAAQRCRQRRRDRI
DKLEKICDKLENDGQKLETEITGLQSEMSHLQKILNNHKCMAMPPRIKNE
REYPFDRYDSRIVSS Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
This polypeptide derives from the following transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
| Term | Definition |
|---|
| GO:0003677 | DNA binding |
| GO:0003700 | transcription factor activity, sequence-specific DNA binding |
Vocabulary: Biological Process
| Term | Definition |
|---|
| GO:0006357 | regulation of transcription from RNA polymerase II promoter |
| GO:0006355 | regulation of transcription, DNA-templated |
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
| Category |
Term Accession |
Term Name |
| biological_process |
GO:0006355 |
regulation of transcription, DNA-templated |
| biological_process |
GO:0006357 |
regulation of transcription from RNA polymerase II promoter |
| molecular_function |
GO:0003677 |
DNA binding |
| molecular_function |
GO:0003700 |
transcription factor activity, sequence-specific DNA binding |
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | COILS | Coil | Coil | coord: 143..177 |
| None | No IPR available | GENE3D | 1.20.5.170 | | coord: 143..188
e-value: 1.7E-12
score: 47.0 |
| None | No IPR available | GENE3D | 1.10.880.10 | | coord: 89..142
e-value: 4.3E-4
score: 20.2 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 1..32 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 45..72 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 89..136 |
| None | No IPR available | SUPERFAMILY | 57959 | Leucine zipper domain | coord: 130..185 |
| IPR000837 | AP-1 transcription factor | PRINTS | PR00042 | LEUZIPPRFOS | coord: 118..134
score: 40.44
coord: 153..174
score: 37.69
coord: 174..197
score: 27.95
coord: 135..151
score: 53.68 |
| IPR004827 | Basic-leucine zipper domain | SMART | SM00338 | brlzneu | coord: 123..187
e-value: 2.9E-11
score: 53.4 |
| IPR004827 | Basic-leucine zipper domain | PFAM | PF00170 | bZIP_1 | coord: 131..184
e-value: 6.1E-11
score: 42.2 |
| IPR004827 | Basic-leucine zipper domain | PROSITE | PS00036 | BZIP_BASIC | coord: 131..145 |
| IPR004827 | Basic-leucine zipper domain | PROSITE | PS50217 | BZIP | coord: 125..188
score: 11.99 |
Blast
The following BLAST results are available for this feature:
|
