Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00056773-protein ID=TCONS_00056773-protein|Name=TCONS_00056773-protein|organism=Clytia hemisphaerica|type=polypeptide|length=156bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00056773-protein vs. Swiss-Prot (Human)
Match: MFAP4 (Microfibril-associated glycoprotein 4 OS=Homo sapiens GN=MFAP4 PE=1 SV=2) HSP 1 Score: 90.5077 bits (223), Expect = 7.918e-23 Identity = 45/104 (43.27%), Postives = 62/104 (59.62%), Query Frame = 0 Query: 51 KCAPCKSVKDSKYCDCTEIQPRQDCLEFYQAGYKINGIYRLHGHRFSV-LNTYCDQTTDNGGWTTFLRRTNGSVNFTRNWNDYKLGFGKLTGEFWFGNENVHDL 153 CAP S + +Q DC + Y GY+ +G+Y ++ SV + +CD TT+ G WT F +R NGSV+F R WNDYKLGFG+ GE+W G +N+H L Sbjct: 17 PCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLL 120 The following BLAST results are available for this feature:
BLAST of TCONS_00056773-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|