Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00055220-protein ID=TCONS_00055220-protein|Name=TCONS_00055220-protein|organism=Clytia hemisphaerica|type=polypeptide|length=436bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00055220-protein vs. Swiss-Prot (Human)
Match: SEM5A (Semaphorin-5A OS=Homo sapiens GN=SEMA5A PE=1 SV=3) HSP 1 Score: 80.4925 bits (197), Expect = 4.737e-16 Identity = 40/110 (36.36%), Postives = 65/110 (59.09%), Query Frame = 0 Query: 333 WSSWTECSASCN-GQKTRHRICDFDDPDFQ----CTTQTQNEDCS-APCPVNGGLSSWSYWEECTKTCGGGRQHRYRYCTSPSPSNGGAFCVGLFNQSRICGVGKCPGTY 436 W+SW++CS C+ G + R R+C+ +P + + ++C+ PCPV+G S WS W +C+ TCGGG R R C++P+P+ GG C+GL + +C CP ++ Sbjct: 790 WTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPVDGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESW 899 The following BLAST results are available for this feature:
BLAST of TCONS_00055220-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|