Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00052427-protein ID=TCONS_00052427-protein|Name=TCONS_00052427-protein|organism=Clytia hemisphaerica|type=polypeptide|length=213bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00052427-protein vs. Swiss-Prot (Human)
Match: ZGLP1 (GATA-type zinc finger protein 1 OS=Homo sapiens GN=ZGLP1 PE=2 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 8.345e-17 Identity = 32/59 (54.24%), Postives = 40/59 (67.80%), Query Frame = 0 Query: 136 KECQSCCTSETLMWRDTEDGIPLCNACGIRWRKYRYRCTECWYVPMQDELKRLNCGSCG 194 + C SC T T +WRD EDG PLCNACGIR++KY RC+ CW VP ++ + CG CG Sbjct: 204 RRCASCRTQRTPLWRDAEDGTPLCNACGIRYKKYGTRCSSCWLVPRKNVQPKRLCGRCG 262 The following BLAST results are available for this feature:
BLAST of TCONS_00052427-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|