Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00052201-protein ID=TCONS_00052201-protein|Name=TCONS_00052201-protein|organism=Clytia hemisphaerica|type=polypeptide|length=149bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00052201-protein vs. Swiss-Prot (Human)
Match: TRUA (tRNA pseudouridine synthase A, mitochondrial OS=Homo sapiens GN=PUS1 PE=1 SV=3) HSP 1 Score: 86.6557 bits (213), Expect = 9.474e-21 Identity = 38/83 (45.78%), Postives = 55/83 (66.27%), Query Frame = 0 Query: 1 LDIPRAPGLGLLLERVEYQQYNEKYGNDGLHNPLTWQDLELEVERFKIECIWQSIMEEEIKKSPMVIWLKTLANHTYSTVGMN 83 +D+P+APGLGL+LERV +++YN+++GNDGLH PL W E +V FK E I+ +I+ E + M WL TL H +S + Sbjct: 323 VDVPKAPGLGLVLERVHFEKYNQRFGNDGLHEPLDWAQEEGKVAAFKEEHIYPTIIGTERDERSMAQWLSTLPIHNFSATALT 405 The following BLAST results are available for this feature:
BLAST of TCONS_00052201-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|