Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00049487-protein ID=TCONS_00049487-protein|Name=TCONS_00049487-protein|organism=Clytia hemisphaerica|type=polypeptide|length=118bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00049487-protein vs. Swiss-Prot (Human)
Match: FHL2 (Four and a half LIM domains protein 2 OS=Homo sapiens GN=FHL2 PE=1 SV=3) HSP 1 Score: 79.7221 bits (195), Expect = 3.932e-19 Identity = 38/114 (33.33%), Postives = 62/114 (54.39%), Query Frame = 0 Query: 5 CTKCDDPIRDTTVTFEKKPYHPECFVCHQCQKKLSGKAIYKHEGHNYDQECYGTFHAKRCAKCYEVLTD-PKVSYVQYDGKTFHPDCFTCSRCDKSLAKQQFYLDGENKLCEKC 117 C +C PI VT+ ++P+H ECFVC C+K+LSG+ + Y C+ +AK+CA C ++ Y+ ++ + +H DCF C +C SL + F + ++ LC C Sbjct: 162 CVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275 The following BLAST results are available for this feature:
BLAST of TCONS_00049487-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|