Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00048344-protein ID=TCONS_00048344-protein|Name=TCONS_00048344-protein|organism=Clytia hemisphaerica|type=polypeptide|length=125bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00048344-protein vs. Swiss-Prot (Human)
Match: HIG2A (HIG1 domain family member 2A, mitochondrial OS=Homo sapiens GN=HIGD2A PE=1 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 3.100e-20 Identity = 37/77 (48.05%), Postives = 51/77 (66.23%), Query Frame = 0 Query: 44 RQEETQTQKLKRKIKENPLVPIGMGATVAALVLGIVNFKRGNQRQQQVMMRARVLAQGGTVVALVTGLYFAAMRDKK 120 R E+ +K RK +ENP+VPIG AT AAL G+ +F RGN ++ Q+MMR R+ AQG TV A++ GL AM+ + Sbjct: 30 RNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP 106 The following BLAST results are available for this feature:
BLAST of TCONS_00048344-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|