Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00046764-protein ID=TCONS_00046764-protein|Name=TCONS_00046764-protein|organism=Clytia hemisphaerica|type=polypeptide|length=175bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00046764-protein vs. Swiss-Prot (Human)
Match: CG050 (Uncharacterized protein C7orf50 OS=Homo sapiens GN=C7orf50 PE=1 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 4.741e-20 Identity = 40/93 (43.01%), Postives = 61/93 (65.59%), Query Frame = 0 Query: 84 AIDYLLGWKSKDKDWKFRKLRQTWLLQNMYDKEKVSKANFKILLEYLEDLKGAAREQTLKEAKEFV-EANEDNEECTEKRKLKRSLNVLKVLT 175 A+DYL W K K+W+F+K RQTWLL +MYD +KV +F LL YLE L+G ARE T+++A+ + E +E+ + + +R VL++L+ Sbjct: 102 ALDYLCRWAQKHKNWRFQKTRQTWLLLHMYDSDKVPDEHFSTLLAYLEGLQGRARELTVQKAEALMRELDEEGSDPPLPGRAQRIRQVLQLLS 194 The following BLAST results are available for this feature:
BLAST of TCONS_00046764-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|