Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00045437-protein ID=TCONS_00045437-protein|Name=TCONS_00045437-protein|organism=Clytia hemisphaerica|type=polypeptide|length=109bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00045437-protein vs. Swiss-Prot (Human)
Match: 5NTD (5'-nucleotidase OS=Homo sapiens GN=NT5E PE=1 SV=1) HSP 1 Score: 98.9821 bits (245), Expect = 1.548e-25 Identity = 43/106 (40.57%), Postives = 67/106 (63.21%), Query Frame = 0 Query: 3 DDGTECPVVQDFTYGKYLGNLKLTFDENGKLLSAQGNPIMLNASYVEDEEVLKMVDEMDDPIIKARTDPIGTTYVLLEGDRSICRLKECNLGNFFADALVDAQVKN 108 DDG + PVVQ + +GKYLG LK+ FDE G ++S+ GNPI+LN+S ED + +++ + T +G T V L+G CR +ECN+GN DA+++ +++ Sbjct: 270 DDGRKVPVVQAYAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNMGNLICDAMINNNLRH 375 The following BLAST results are available for this feature:
BLAST of TCONS_00045437-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|