Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00044763-protein ID=TCONS_00044763-protein|Name=TCONS_00044763-protein|organism=Clytia hemisphaerica|type=polypeptide|length=127bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00044763-protein vs. Swiss-Prot (Human)
Match: NLK (Serine/threonine-protein kinase NLK OS=Homo sapiens GN=NLK PE=1 SV=2) HSP 1 Score: 98.9821 bits (245), Expect = 2.303e-25 Identity = 42/51 (82.35%), Postives = 48/51 (94.12%), Query Frame = 0 Query: 77 LEADRPIGYGAFGVVWAVTDPRTGKRIALKKMPNVFQNIVSSKRVYRELRM 127 +E DRPIGYGAFGVVW+VTDPR GKR+ALKKMPNVFQN+VS KRV+REL+M Sbjct: 138 IEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKM 188 The following BLAST results are available for this feature:
BLAST of TCONS_00044763-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|