Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00043618-protein ID=TCONS_00043618-protein|Name=TCONS_00043618-protein|organism=Clytia hemisphaerica|type=polypeptide|length=144bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00043618-protein vs. Swiss-Prot (Human)
Match: CSEN (Calsenilin OS=Homo sapiens GN=KCNIP3 PE=1 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 7.612e-16 Identity = 34/101 (33.66%), Postives = 61/101 (60.40%), Query Frame = 0 Query: 1 QDFVIGLSNCLHGDSEKKLQWAFRVYDNEEKGYLLEDELFNVLTYIYNLIGIKIQDDEKE-KLMEHTSGLFELLDIDSDGRISEEEFVNGCLKNHDMVEAL 100 +DFV+GLS L G +KL+WAF +YD + GY+ ++E+ ++ IY+++G +E EH FE +D + DG ++ EEF+ C K+ +++ ++ Sbjct: 149 EDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSM 249 The following BLAST results are available for this feature:
BLAST of TCONS_00043618-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|