Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00043509-protein ID=TCONS_00043509-protein|Name=TCONS_00043509-protein|organism=Clytia hemisphaerica|type=polypeptide|length=106bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00043509-protein vs. Swiss-Prot (Human)
Match: HACD3 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens GN=HACD3 PE=1 SV=2) HSP 1 Score: 77.0258 bits (188), Expect = 5.347e-18 Identity = 39/98 (39.80%), Postives = 57/98 (58.16%), Query Frame = 0 Query: 4 KRFHQDSVVFVLFIVWSFIEIIRYPFYLLGLYRYNNKVMTWLRYNIWIPLYPTGFTSEAIIMYRSIPFSLENKRMEYNMPNALNFQFSLRGFTILYLV 101 + +VVF +F +WS IEI RY FY+L + KV+TWLRY +WIPLYP G +EA+ + +SIP E R + +P + + F +YL+ Sbjct: 236 EEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLI 333 The following BLAST results are available for this feature:
BLAST of TCONS_00043509-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|