Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00019383-protein ID=TCONS_00019383-protein|Name=TCONS_00019383-protein|organism=Clytia hemisphaerica|type=polypeptide|length=547bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00019383-protein vs. Swiss-Prot (Human)
Match: ARI3A (AT-rich interactive domain-containing protein 3A OS=Homo sapiens GN=ARID3A PE=1 SV=2) HSP 1 Score: 112.079 bits (279), Expect = 3.877e-26 Identity = 45/107 (42.06%), Postives = 74/107 (69.16%), Query Frame = 0 Query: 219 WLYEENIKKLYNLDKNPQRQIFLDEFFSYRRTHGLYC-KIPVIARKPLDVFLLYSIVQKYGGFEQTMKNRMWSQIARELELPRTMTSGAFTLKLKYIRLLYQFECYK 324 W YEE K+LY LD +P+R+ FLD+ FS+ + G +IP++A++ LD+F+LY +V + GG + + ++W +I + L LP ++TS AFTL+ +Y++ LY +EC K Sbjct: 223 WTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEK 329 The following BLAST results are available for this feature:
BLAST of TCONS_00019383-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|