Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00009438-protein ID=TCONS_00009438-protein|Name=TCONS_00009438-protein|organism=Clytia hemisphaerica|type=polypeptide|length=169bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term Definition
IPR006153 Cation/H_exchanger
Vocabulary: Cellular Component
Term Definition
GO:0016021 integral component of membrane
Vocabulary: Biological Process
Term Definition
GO:0006812 cation transport GO:0055085 transmembrane transport
Vocabulary: Molecular Function
Term Definition
GO:0015299 solute:proton antiporter activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
biological_process
GO:0006812 cation transport
biological_process
GO:0055085 transmembrane transport
cellular_component
GO:0016021 integral component of membrane
molecular_function
GO:0015299 solute:proton antiporter activity
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
G V T M L T F V A N K C G R L T K V K K V E Q F I M S Y G G L R G A V A F C L A M L I K E D D T P S I D G K P S S Q E F K Q T I V T T T I S V V L F T C F I Q G T T I K K L V D I L G V K K S F K R D K S M A E T V N D R M L G Y M V A G I E E I I G V H G H G F W R N L L E L F N K K Y L R R W L E R D P D N P L D D S L L A H Q R R I A F K Y 20 40 60 80 100 120 140 160 Expect = 1.8E-9 / Score = 36.8 Sequence PF00999
IPR Term IPR Description Source Source Term Source Description Alignment
IPR006153 Cation/H+ exchanger PFAM PF00999 Na_H_Exchanger coord: 14..86
Blast
BLAST of TCONS_00009438-protein vs. Swiss-Prot (Human)
Match:
SL9A1 (Sodium/hydrogen exchanger 1 OS=Homo sapiens GN=SLC9A1 PE=1 SV=2)
HSP 1 Score: 112.079 bits (279), Expect = 3.773e-29
Identity = 59/146 (40.41%), Postives = 90/146 (61.64%), Query Frame = 0
Query: 1 GVTMLTFVANKCGRLTKVKKVEQFIMSYGGLRGAVAFCLAMLIKEDDTPSIDGKPSSQEFKQTIVTTTISVVLFTCFIQGTTIKKLVDILGVKKSFKRDKSMAETVNDRMLGYMVAGIEEIIGVHGHGFWRNLLELFNKKYLRRWL 146
GV LT+ NK R+ K+ +QFI++YGGLRGA+AF L L+ + P D +T I+V+ FT F+QG TI+ LVD+L VKK + +S+ E ++ + L +++ GIE+I G +GH W++ L FNKKY+++ L
Sbjct: 428 GVLGLTWFINKF-RIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCD----------LFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKKCL 562
The following BLAST results are available for this feature:
BLAST of TCONS_00009438-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
G V T M L T F V A N K C G R L T K V K K V E Q F I M S Y G G L R G A V A F C L A M L I K E D D T P S I D G K P S S Q E F K Q T I V T T T I S V V L F T C F I Q G T T I K K L V D I L G V K K S F K R D K S M A E T V N D R M L G Y M V A G I E E I I G V H G H G F W R N L L E L F N K K Y L R R W L E R D P D N P L D D S L L A H Q R R I A F K Y 20 40 60 80 100 120 140 160 Expect = 3.77e-29 / Id = 40.41 Sequence SL9A1
Match Name E-value Identity Description
SL9A1 3.773e-29 40.41 Sodium/hydrogen exchanger 1 OS=Homo sapiens GN=SLC... [more]
back to top
