Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00007520-protein ID=TCONS_00007520-protein|Name=TCONS_00007520-protein|organism=Clytia hemisphaerica|type=polypeptide|length=311bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00007520-protein vs. Swiss-Prot (Human)
Match: FOXL1 (Forkhead box protein L1 OS=Homo sapiens GN=FOXL1 PE=2 SV=2) HSP 1 Score: 88.5817 bits (218), Expect = 5.494e-20 Identity = 39/90 (43.33%), Postives = 58/90 (64.44%), Query Frame = 0 Query: 131 SYTAMIAQAVLSTPQHKITLGGIYDFIEMNYKGLEKRVKGWRNCVRHNLSLNECFIKLGRSEN--GRGNDWTIHPNYLNSFMKGEYRKRR 218 SY A+IA A+ P+ ++TL GIY FI + +GW+N +RHNLSLN+CF+K+ R + G+G+ WT+ P L+ F G YR+R+ Sbjct: 53 SYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRK 142 The following BLAST results are available for this feature:
BLAST of TCONS_00007520-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|