Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00007360-protein ID=TCONS_00007360-protein|Name=TCONS_00007360-protein|organism=Clytia hemisphaerica|type=polypeptide|length=100bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00007360-protein vs. Swiss-Prot (Human)
Match: APC11 (Anaphase-promoting complex subunit 11 OS=Homo sapiens GN=ANAPC11 PE=1 SV=1) HSP 1 Score: 145.591 bits (366), Expect = 3.477e-47 Identity = 64/84 (76.19%), Postives = 74/84 (88.10%), Query Frame = 0 Query: 17 MKVKVKSWMAVAVWHWITNDDTCGICRMQFDGCCPDCKVPGDDCPLVWGRCSHVFHMHCILKWLNSQQSQQHCPMCRREWQFKD 100 MKVK+K W VA W W+ ND+ CGICRM F+GCCPDCKVPGDDCPLVWG+CSH FHMHCILKWL++QQ QQHCPMCR+EW+FK+ Sbjct: 1 MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE 84 The following BLAST results are available for this feature:
BLAST of TCONS_00007360-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|