Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00006807-protein ID=TCONS_00006807-protein|Name=TCONS_00006807-protein|organism=Clytia hemisphaerica|type=polypeptide|length=145bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00006807-protein vs. Swiss-Prot (Human)
Match: S22A5 (Solute carrier family 22 member 5 OS=Homo sapiens GN=SLC22A5 PE=1 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 1.859e-20 Identity = 42/97 (43.30%), Postives = 66/97 (68.04%), Query Frame = 0 Query: 25 ALILALIGKFGISAAFVTIDLYTVELFPTVVRTLGMGTCIFWSRVGGMIAPQILLLGGVSINILPTIIIGVMALLAALDVYFLPETFGKRLPNTIEE 121 A +L ++GKFG++AAF + +YT EL+PTVVR +G+G SR+G +++P + LG LP I++G + +L A+ FLPE+FG LP+TI++ Sbjct: 428 ATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYD-RFLPYILMGSLTILTAILTLFLPESFGTPLPDTIDQ 523 The following BLAST results are available for this feature:
BLAST of TCONS_00006807-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|