Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00004400-protein ID=TCONS_00004400-protein|Name=TCONS_00004400-protein|organism=Clytia hemisphaerica|type=polypeptide|length=105bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00004400-protein vs. Swiss-Prot (Human)
Match: MEIG1 (Meiosis expressed gene 1 protein homolog OS=Homo sapiens GN=MEIG1 PE=3 SV=1) HSP 1 Score: 107.457 bits (267), Expect = 5.355e-32 Identity = 49/85 (57.65%), Postives = 64/85 (75.29%), Query Frame = 0 Query: 21 TSPQPKSVLRPKQWDPYVEEAYRFQVAGYRDEKEYKHLQNDEEVDRWPDTGYVKKLQRKDGTFYYYSKARECKEKDVNRTKLYAY 105 + +PKSV K+W +E YRFQ AGYRDE EY+ ++ VDRWP+TGYVKKLQR+D TFYYY+K REC +K+V++ K+YAY Sbjct: 4 SDVKPKSVSHAKKWSEEIENLYRFQQAGYRDETEYRQVKQVSMVDRWPETGYVKKLQRRDNTFYYYNKQRECDDKEVHKVKIYAY 88 The following BLAST results are available for this feature:
BLAST of TCONS_00004400-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|