Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00004064-protein ID=TCONS_00004064-protein|Name=TCONS_00004064-protein|organism=Clytia hemisphaerica|type=polypeptide|length=168bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00004064-protein vs. Swiss-Prot (Human)
Match: SAM15 (Sterile alpha motif domain-containing protein 15 OS=Homo sapiens GN=SAMD15 PE=2 SV=1) HSP 1 Score: 114.775 bits (286), Expect = 3.192e-30 Identity = 56/125 (44.80%), Postives = 83/125 (66.40%), Query Frame = 0 Query: 15 PVKKYHKTFDHNGIPFVMRWSIDDVAEWVTSELKFPQYKDCFRNNYVSGKRLVQMTASNLPRMGITDFEHIKKITYEIRQLLGIEEPNWNRSITLPPKDTVEHYLERKSVSGRNTDGLTFEEHVR 139 P K F+H + W ++VAEW+ S+L FPQYK+CF N++SG++L+ + SNLP+MGIT+FE +K I+ ++LL IEEP + RSI+LP +D + YLE+K +G +D LT E V+ Sbjct: 532 PEKGTELQFEH------LNWDPEEVAEWI-SQLGFPQYKECFITNFISGRKLIHVNCSNLPQMGITNFEDMKAISRHTQELLEIEEPLFKRSISLPYRDIIGLYLEQKGHTGIKSDSLTLSEFVK 649 The following BLAST results are available for this feature:
BLAST of TCONS_00004064-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|