Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00003598-protein ID=TCONS_00003598-protein|Name=TCONS_00003598-protein|organism=Clytia hemisphaerica|type=polypeptide|length=196bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00003598-protein vs. Swiss-Prot (Human)
Match: TSTD1 (Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1 OS=Homo sapiens GN=TSTD1 PE=1 SV=3) HSP 1 Score: 77.411 bits (189), Expect = 9.396e-19 Identity = 45/111 (40.54%), Postives = 63/111 (56.76%), Query Frame = 0 Query: 85 VSCDELREDIANDEKMYIIDVREPMEVEFDGKIPGSVLIPAGEIEDALRLPDEAFEKVYGYPKPPEDGEDVVVYCAAGVRSLRATLLLRSLGYEETRSLAGGIKAWYETKS 195 VS ELR +A+ + + DVR E G IPG++ IP E+E AL++ AF+ +Y KP + E +V +C G R L+AT L RSLGY R+ AG + W E +S Sbjct: 7 VSLPELRSLLASG-RARLFDVRSREEAA-AGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEKES 115 The following BLAST results are available for this feature:
BLAST of TCONS_00003598-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|