Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00003236-protein ID=TCONS_00003236-protein|Name=TCONS_00003236-protein|organism=Clytia hemisphaerica|type=polypeptide|length=214bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00003236-protein vs. Swiss-Prot (Human)
Match: ANGP2 (Angiopoietin-2 OS=Homo sapiens GN=ANGPT2 PE=1 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 2.743e-16 Identity = 35/74 (47.30%), Postives = 49/74 (66.22%), Query Frame = 0 Query: 111 YKDCDSWLQSGYKTSGVYEITFDERLQDV--YCEMDVTKNKGWIIIQKRFDGSVDFDRLWTDYKNGFGNVEGEY 182 ++DC +SG+ T+G+Y +TF +++ YC+M+ GW IIQ+R DGSVDF R W +YK GFGN GEY Sbjct: 281 FRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGG-GWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEY 353 The following BLAST results are available for this feature:
BLAST of TCONS_00003236-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|