Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00003092-protein ID=TCONS_00003092-protein|Name=TCONS_00003092-protein|organism=Clytia hemisphaerica|type=polypeptide|length=418bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00003092-protein vs. Swiss-Prot (Human)
Match: ZNRF2 (E3 ubiquitin-protein ligase ZNRF2 OS=Homo sapiens GN=ZNRF2 PE=1 SV=1) HSP 1 Score: 140.969 bits (354), Expect = 3.069e-39 Identity = 56/96 (58.33%), Postives = 73/96 (76.04%), Query Frame = 0 Query: 71 SLPSHLFPFVTAEIKCPVCNKRIGTSEIESHLLACLSKPRVSYNEDTLKSDAGECIICFDDMIAGEHIARLPCLCIYHKKCLDEWFQRNRCCPAHP 166 SLP+HL P + KCPVC+K + + E++ HL+ CL+KPR++YNED L DAGEC IC +++ G+ IARLPCLCIYHK C+DEWF+ NR CP HP Sbjct: 145 SLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHP 240 The following BLAST results are available for this feature:
BLAST of TCONS_00003092-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|