Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00002352-protein ID=TCONS_00002352-protein|Name=TCONS_00002352-protein|organism=Clytia hemisphaerica|type=polypeptide|length=106bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00002352-protein vs. Swiss-Prot (Human)
Match: AP1S1 (AP-1 complex subunit sigma-1A OS=Homo sapiens GN=AP1S1 PE=1 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 5.148e-24 Identity = 39/65 (60.00%), Postives = 54/65 (83.08%), Query Frame = 0 Query: 30 MWQYIFLFSRQGKVRLQKWYNTYTQKEKKKIMRDLLTIILARKPKMCSFLEYKDSKVCYKRYVKI 94 M +++ LFSRQGK+RLQKWY + KE+KK++R+L+ ++LARKPKMCSFLE++D KV YKRY + Sbjct: 1 MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASL 65 The following BLAST results are available for this feature:
BLAST of TCONS_00002352-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|