Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002147-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00002147-protein
Unique NameTCONS_00002147-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length591

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00002147-protein ID=TCONS_00002147-protein|Name=TCONS_00002147-protein|organism=Clytia hemisphaerica|type=polypeptide|length=591bp
MVKESKAMDRIILTSVKIKCLQAQLGCDWQGELSSVEKHEEKCKYKSIQC
SNKGCRSEMMRMNLLKHLNNCQYQIVACEFCATKVPQIDMEDHRIDCDFC
PKKCPNENCQVKIRNTELDAHLEQDCQYEPVECRYSAFGCEDKIKRIDMK
LHLDESVHDHMSLLFKSNQDLEKSHRETKQELDDAQQRLVKTTMVLKEFN
EMLNQTRRELEATKREFAAFRKETSEKIAEQDAQLEKYKNQPRAPTPTRI
EPLKSPRDSPVSKSPRQSPEPGTNIPIGRKSPEPVKERRTPSPTSDDKKG
GILKKAKSADNLTTAGRSSSPVTLKLFLKKSDSPINVTRSDSNASSSSSS
SAGSTNPPPPQIVSKNPLSPLTPLSPMSPTKRVSPPPPGAKDLPDEPRSP
QNGETTLQRKRQAAIKPIITRPSTPLQSIIDAMNNSPINDYPQHFHAMMQ
NMEPDRFYVVNGDLLIKVNTFGSLRPYAVVYVQPWEERSRKVFQEMRLNK
RTKHHSERVCIEANSQVGIVKLLVNCTLQDTIVSVVCTQQNTAFLPSYIE
TMGWGFQVPAGLHRNAFFHQENMLLRLRQRIPDVERMAAGM
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_001120XLOC_001120Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00002147TCONS_00002147Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR001293Znf_TRAF
IPR008974TRAF-like
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
molecular_function GO:0008270 zinc ion binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 168..188
NoneNo IPR availableCOILSCoilCoilcoord: 196..241
NoneNo IPR availableGENE3D1.20.1270.60coord: 144..453
e-value: 5.8E-4
score: 19.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 232..421
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3D3.30.40.10coord: 58..94
e-value: 2.6E-9
score: 36.6
coord: 10..57
e-value: 2.4E-14
score: 52.7
coord: 97..143
e-value: 8.0E-12
score: 44.7
IPR001293Zinc finger, TRAF-typePFAMPF02176zf-TRAFcoord: 93..152
e-value: 8.7E-11
score: 42.3
IPR001293Zinc finger, TRAF-typePROSITEPS50145ZF_TRAFcoord: 93..150
score: 12.174
IPR001293Zinc finger, TRAF-typePROSITEPS50145ZF_TRAFcoord: 39..91
score: 10.857
IPR008974TRAF-likeSUPERFAMILY49599TRAF domain-likecoord: 76..150
IPR008974TRAF-likeSUPERFAMILY49599TRAF domain-likecoord: 15..81

Blast
BLAST of TCONS_00002147-protein vs. Swiss-Prot (Human)
Match: TRAF5 (TNF receptor-associated factor 5 OS=Homo sapiens GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 4.977e-16
Identity = 55/195 (28.21%), Postives = 103/195 (52.82%), Query Frame = 0
Query:   26 GCDWQGELSSVEKHEEKCKYKSIQCSNKGCRSEMMRMNLLKHLN-NCQYQIVACEFCATKVPQIDMEDHRID-CDFCPKKCPNENCQVKIRNTELDAHLEQDCQYEPVECRYSAFGCEDKIKRIDMKLHLDESVHDHMSLLFKSNQDLEKSHRETKQELDDAQQRLVKTTMVLKEFNEMLNQTRRELEATKREFA 218
            GC+ +  L   + H ++C ++ +QCSN+ CR  ++R +L +HL+ +CQ++   C +C   V  I++++H  + C   P  CPN NC   I  TE+D HL   C     +C +  +GC    KR +++ H   ++ +HM L+ + N  LE+   +  + L+  + ++           + L +T ++LE   ++FA
Sbjct:  115 GCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPN-NCAKIILKTEVDEHLAV-CPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKI-----------QQLAETIKKLEKEFKQFA 296          
The following BLAST results are available for this feature:
BLAST of TCONS_00002147-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TRAF54.977e-1628.21TNF receptor-associated factor 5 OS=Homo sapiens G... [more]
back to top