Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002139-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00002139-protein
Unique NameTCONS_00002139-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length321

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00002139-protein ID=TCONS_00002139-protein|Name=TCONS_00002139-protein|organism=Clytia hemisphaerica|type=polypeptide|length=321bp
MMFKRKRKNIIIFVVGCFCGIYLENILKKYMDRRFYSNQEDTNNTWHLVP
EKHNIKNGALYFTGKNLYHKNSEASNYFHSIPILCWVLTTKDTLHTKAQA
VKDTWGQRCQVLLFFSSEDDPSFPAISLDVKEGYMNLHEKVKAAWRYIFK
HHSKDASWFIKADDDTFLIMENLRHFLSSYSSSDKLFFGHNLWHHSTDYN
SGGAGYIFSRQTLIEYFSISKTCESKSNAEDVAVAACLKKVGITPSDTRD
DDGRETFHPFAPDFHLIPGSIGKDNWLYQRSRWELVEGVGCCSKYSIAFH
YTTTKRMYLLNYYLYVLKKGF
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_001115XLOC_001115Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00002139TCONS_00002139Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR003378Fringe-like
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Molecular Function
TermDefinition
GO:0016757transferase activity, transferring glycosyl groups
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016020 membrane
molecular_function GO:0016757 transferase activity, transferring glycosyl groups
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003378Fringe-likePFAMPF02434Fringecoord: 85..242
e-value: 8.0E-11
score: 41.8

Blast
BLAST of TCONS_00002139-protein vs. Swiss-Prot (Human)
Match: C1GLT (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens GN=C1GALT1 PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 5.785e-69
Identity = 116/320 (36.25%), Postives = 176/320 (55.00%), Query Frame = 0
Query:    9 NIIIFVVGCFCGIYL-ENILKKYMDRRFYSNQEDTNNTWHLVPEKHNIKN---GALYFTGKNLYHKNSE---ASNYFHSIPILCWVLTTKDTLHTKAQAVKDTWGQRCQVLLFFSSEDDPSFPAISLDVKEGYMNLHEKVKAAWRYIFKHHSKDASWFIKADDDTFLIMENLRHFLSSYSSSDKLFFGHNLWHH-STDYNSGGAGYIFSRQTLIEYFSISKT--CESKSNAEDVAVAACLKKVGITPSDTRDDDGRETFHPFAPDFHLIPGSIGKDNWLYQRSRWELVEGVGCCSKYSIAFHYTTTKRMYLLNYYLYVLK 318
            N + F+ G   G  L   +    +  +  +     +N  H      N +N   G + F   +  HK+     A N +  + ILCWV+T    L  KA+ VK TW QRC  +LF SSE++  FPA+ L  KEG   L+ K   A++Y+ +H+ +DA WF+KADDDT++I++NLR  LS Y   + ++FG     +    Y SGGAGY+ S++ L  +    KT  C   S+ ED+A+  C++ + +   D+RD  G+ETFHPF P+ HLI G + +  W +  + +  VEG GCCS  +++FHY  +  MY L Y +Y L+
Sbjct:    8 NFLTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLR 327          
The following BLAST results are available for this feature:
BLAST of TCONS_00002139-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
C1GLT5.785e-6936.25Glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
back to top