Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00001703-protein ID=TCONS_00001703-protein|Name=TCONS_00001703-protein|organism=Clytia hemisphaerica|type=polypeptide|length=541bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00001703-protein vs. Swiss-Prot (Human)
Match: FOXI1 (Forkhead box protein I1 OS=Homo sapiens GN=FOXI1 PE=1 SV=3) HSP 1 Score: 83.9593 bits (206), Expect = 1.655e-17 Identity = 38/90 (42.22%), Postives = 55/90 (61.11%), Query Frame = 0 Query: 316 SYTAMIAQAILKKESSKSTLSDIYEYMEKHFPSLEKRGTGWRNCVRHTLSLNDCFIKLHRPEN--GRSCNWAIHPTYYESFSKGDYRKRR 403 SY+A+IA AI + TLS IY+Y+ +FP K GW+N +RH LSLNDCF K+ R E+ G+ W + P + F G++R++R Sbjct: 127 SYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKR 216 The following BLAST results are available for this feature:
BLAST of TCONS_00001703-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|