Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001641-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001641-protein
Unique NameTCONS_00001641-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length151

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001641-protein ID=TCONS_00001641-protein|Name=TCONS_00001641-protein|organism=Clytia hemisphaerica|type=polypeptide|length=151bp
QIFKKCMTKPIERQREEEILSCLSLIALMLKYDDVQKDGSKERLHHIWSY
VFQCSLPEQSDAVRYNMAGMLCLLAEHACLEPINHYQLYYCALNLLNDCD
ADIRRHAAQEIHKAYSSNGNRKFLPSLCPGFKTLLYFSLHCFRINHTYSE
Y
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000855XLOC_000855Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001641TCONS_00001641Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: Molecular Function
TermDefinition
GO:0005488binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005488 binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011989Armadillo-like helicalGENE3D1.25.10.10coord: 2..145
e-value: 5.0E-7
score: 28.1
IPR016024Armadillo-type foldSUPERFAMILY48371ARM repeatcoord: 20..134

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001641-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top