Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001599-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001599-protein
Unique NameTCONS_00001599-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length181

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001599-protein ID=TCONS_00001599-protein|Name=TCONS_00001599-protein|organism=Clytia hemisphaerica|type=polypeptide|length=181bp
MATMFMDTSEDQSLNAKSALRNALRAKLKSSSSFEDTTTTSSTTSFDLTR
TSSMSSNLNYDDTSIKLIDVETLGNESDESGESDEKMDEKESSTAVSSIP
LEERRLRNRLAARKCREKRKQRIMNLEKICNNLESRIDMLTAEIEGLDGQ
KKNLTRLLENHNCVRLTPKPTAVIKNAVMSK
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000833XLOC_000833Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001599TCONS_00001599Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR004827bZIP
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Molecular Function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 116..157
NoneNo IPR availableGENE3D1.20.5.170coord: 116..161
e-value: 2.6E-10
score: 40.0
NoneNo IPR availableGENE3D1.10.880.10coord: 9..115
e-value: 3.1E-6
score: 27.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 72..97
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 27..55
NoneNo IPR availableSUPERFAMILY57959Leucine zipper domaincoord: 101..155
IPR004827Basic-leucine zipper domainSMARTSM00338brlzneucoord: 96..160
e-value: 1.0E-8
score: 45.0
IPR004827Basic-leucine zipper domainPFAMPF07716bZIP_2coord: 103..147
e-value: 8.4E-11
score: 41.7
IPR004827Basic-leucine zipper domainPROSITEPS00036BZIP_BASICcoord: 104..118
IPR004827Basic-leucine zipper domainPROSITEPS50217BZIPcoord: 102..161
score: 10.553

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001599-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top