Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00001579-protein ID=TCONS_00001579-protein|Name=TCONS_00001579-protein|organism=Clytia hemisphaerica|type=polypeptide|length=249bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00001579-protein vs. Swiss-Prot (Human)
Match: RT18B (28S ribosomal protein S18b, mitochondrial OS=Homo sapiens GN=MRPS18B PE=1 SV=1) HSP 1 Score: 102.834 bits (255), Expect = 2.232e-26 Identity = 52/115 (45.22%), Postives = 71/115 (61.74%), Query Frame = 0 Query: 110 VEDTENVDSQDERLVWHGYKRNFKGQFPPEKPRKTCIRNNGNRVSGNPCPLCQIKLKSSYNVHFTDVQLLEQFICPHTAEILSPKVTGICKKQHLQVEAAIKKARNFGYLPFTLP 224 +E E + R VW Y+RN KG PP++ RKTCIR N +V GNPCP+C+ +V F +V+LLEQF+C HT I TG+C KQH ++ AI+KAR+ G L + +P Sbjct: 59 LESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRN--KVVGNPCPICR---DHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIP 168 The following BLAST results are available for this feature:
BLAST of TCONS_00001579-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|