Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001518-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001518-protein
Unique NameTCONS_00001518-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length441

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001518-protein ID=TCONS_00001518-protein|Name=TCONS_00001518-protein|organism=Clytia hemisphaerica|type=polypeptide|length=441bp
MFLEVILESMKRKLRLSENPSATKYEVVKQDEIPPDECPPNQMQQPKSKG
GGILCASSRKRFYFLLIITGVVLLWIGIYYKLLNHRFELPEPFRELRRMF
GDGPSKNRRRFRESETENIEEVSLHNAAILNIVVVACKDRVGQAITALKS
ATLFTKYNVHFHIFTDKTDDKKLDNELMTWPSYQERWMMYYIYPAKYPDM
LEDDEKVDWEELFKPCASLRLFLAQLLPTTDSVIYIDTDILFLKPPEDLW
NLFNDFDKRQAVGLAQECGKGQEFCWYSKGPKKARHPYVQPYGVNSGVML
MNLTRLRRLNWEKELISIYTNNRLLIRYGDQDILNIFLNAHPKFLYTLPC
EWNYRPDFCYLGNHCHRAIKNGIGILHGCRLSFQKPKVQPEFHAIYEAFK
EYSFEDSVEDKIVNVTKFVFKKKFSKTTCGQMMNSILMFNT
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000777XLOC_000777Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001518TCONS_00001518Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR029044Nucleotide-diphossugar_trans
IPR002495Glyco_trans_8
Vocabulary: Molecular Function
TermDefinition
GO:0016757transferase activity, transferring glycosyl groups
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0016757 transferase activity, transferring glycosyl groups
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029044Nucleotide-diphospho-sugar transferasesGENE3D3.90.550.10coord: 130..417
e-value: 6.1E-41
score: 140.0
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILY53448Nucleotide-diphospho-sugar transferasescoord: 131..402
IPR002495Glycosyl transferase, family 8PFAMPF01501Glyco_transf_8coord: 132..377
e-value: 3.8E-26
score: 92.1

Blast
BLAST of TCONS_00001518-protein vs. Swiss-Prot (Human)
Match: GXLT2 (Glucoside xylosyltransferase 2 OS=Homo sapiens GN=GXYLT2 PE=2 SV=2)

HSP 1 Score: 228.024 bits (580), Expect = 6.481e-70
Identity = 121/319 (37.93%), Postives = 180/319 (56.43%), Query Frame = 0
Query:  130 LNIVVVACKDRVGQAITALKSATLFTKYNVHFHIFTDKTDDKKLDNELMTWPSYQERWMMYYIYPAKYPDMLEDDEKVDWEELFKPCASLRLFLAQLLPTTDSVIYIDTDILFLKPPEDLWNLFNDFDKRQAVGLAQECGKGQEFCWYSKGPKKARHPYVQPYGVNSGVMLMNLTRLRR-----------LNWEKELISIYTNNRLLIRYGDQDILNIFLNAHPKFLYTLPCEWNYRPDFCYLGNHCHRAIKNGIGILHGCRLSFQKPKVQPEFHAIYEAFKEYSFEDSVEDKIVNVTKFVFKKKFSKTTCGQMMNSIL 437
            +++ VVAC +R+ + +  LKSA LF+   + FHIFT+ +   + D +L  WP    +   + IYP  +          +W++LFKPCA+ RLFL  +L   DS++Y+DTD+LFL+P +D+W L   F+  Q   +A E  +  +  WYS+    ARHP+    GVNSGVMLMNLTR+R            L WE  L  +Y   +  I +GDQD+LNI    +P+ LY  PC+WNYRPD C  G++C  A   G+ +LHG R  +   K QP F A+YEA +++ F+D++   +    +  F +    T CG++    L
Sbjct:  110 IHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSYTKKFEHRIYPITF----SVGNPQEWKKLFKPCAAQRLFLPVILKDVDSLLYVDTDVLFLRPVDDIWKLLRLFNSTQLAAMAPE-HEIPKIGWYSRF---ARHPFYGSAGVNSGVMLMNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQDLLNIIFYFNPECLYVFPCQWNYRPDHCMYGSNCREAEHEGVSVLHGNRGVYHDDK-QPTFRALYEAIRDFPFQDNLFQSMYYPLQLKFLETV-HTLCGRIPQVFL 418          
The following BLAST results are available for this feature:
BLAST of TCONS_00001518-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GXLT26.481e-7037.93Glucoside xylosyltransferase 2 OS=Homo sapiens GN=... [more]
back to top