Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001385-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001385-protein
Unique NameTCONS_00001385-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length492

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001385-protein ID=TCONS_00001385-protein|Name=TCONS_00001385-protein|organism=Clytia hemisphaerica|type=polypeptide|length=492bp
MANKRKQKTSAEMKSIASKIIKIDERKEKLVPFDFDDNDYDVIIITRENE
VYLPSGFVKMLSNGKDIQLRDGRMNIDASTECLVRCLSFYDLRFWDETQV
FENLRDVLSVTKMLKMKGLRDHIENEEFLPLIRAPSVSIHLTDSLLAHLG
IAHEFGLHCFVQKIMVRNVPLRNFNLIKSPSFNRLHRDLRFEILKNTIND
QFSDSSHFNHELLEIQIIFNFFDFIVFENRSLNVAPQKSYVVSPAINTSW
NSFEETVARRFIPYDKDLTDSVTLIVENKEIYVNSYLLTTNSPVFKAMLN
SVSFKEGQSKRVELPGKKHSEILFFLHHLQTPQDIGNIIDFPDITILAPL
CREYQVDWLTKKIKDFIRVRAARLNKKGSKIVALNYLSFSEEIGFDESND
TLLVNSLSCGFHSLQTCLEFSVLSRHKQVLIARKRLWLLLRHFFDKYRDL
ILNEEGFGFLSLFEEQTVFDFQYNKTECAYIKEFQEKHGKGE
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000736XLOC_000736Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001385TCONS_00001385Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000210BTB/POZ_dom
IPR011333SKP1/BTB/POZ
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 270..371
e-value: 4.6E-7
score: 39.5
IPR000210BTB/POZ domainPFAMPF00651BTBcoord: 272..331
e-value: 5.1E-5
score: 23.4
IPR000210BTB/POZ domainPROSITEPS50097BTBcoord: 270..341
score: 9.744
NoneNo IPR availableGENE3D3.30.710.10coord: 264..433
e-value: 1.3E-11
score: 44.1
IPR011333SKP1/BTB/POZ domainSUPERFAMILY54695POZ domaincoord: 268..366

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001385-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top