Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001380-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001380-protein
Unique NameTCONS_00001380-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1924

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001380-protein ID=TCONS_00001380-protein|Name=TCONS_00001380-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1924bp
MPGMEATIKEPTSPLPVLYPITVYTTILTPDGKVKTEVNVTIKTTVSDAI
QTVLDSFSIVSSVELFDLCEVYSEFGVFPTDPDAVFENLRSLSYSEYPLA
VQKAWTAGAPNGLDRSNMSEDELSEKSPMNNIQSYRLYLTQKSDQLEGGR
DVKVTWLDGLDKKIPPEAWHFDPLYREKTDIDDLVALPVLNETVLLDQLC
TRFCKGRIYTYVGGILIAINPFKYFPIYNPKYVNAYQNKKLGELPPHVFA
IADAAYNRMLISKQNQCIVISGESGSGKTESTKLILHHLTALSHKTKATV
LEKTILAAGPVLEAFGNAKTSYNNNSSRFGKFTQINYRADGVVCGAVLKK
YLLEKSRIVQQGINERNYHVFYSMLAGASQTERETLHLLTPQEYFYLNQT
QCYTIEGMDEVYEFARLKNSIKNIGIPSITQQRMFAVLSAVLHIGNITFR
KRSFPEDSVSVADEKIIEIIAELIQVDKQELIVPMTMRKTITRGEEFVRQ
YKKDEAIATRDSMAKCLYASLFDWIVLQTNHIMVSKQGRKVDKKAFSIGV
LDIFGFEDFERNSFEQFCINLANENLQFYLNQHIFKIRQDEYVEEGLDWD
HVDYADNSTCLNLMVGKPTGLILLLDEECSLTIGTDESLLDKFNQHHSNN
TCYEMPPTREPVFSILHYAGKVKYQIEGFRAKNRELMRNDVVSVFRNSRM
LFVRELMGSDPVAIYYWSILRHTIKAVSIFKKAGAARAKGQRMFEPKASV
SWMKSKTPPNKSKALMRQLTEAEIDTTGQAMMRRATKVMNRRVLDMAKRI
QSPSRMRSGLEARRTISGGMSEYARRGGLKQPPTVVAQFQSSLMELMDAL
NQSHPFFVRCIRSNAVKAPLKFEAELVLRQLRYTGMLETVKIRQAGYPVR
IFVKQFVNQFRILLRAKDLDRISEDELTQMLTDLGLDTDEFQVGANKVFM
RESQYQLLRDKMQQAVDRAATTIQVWYHRRYLRKLKELEISSAIIIQKYW
RGFVCRREYVYYQETRLRNRSARRIQNFWRTHEQTAARKPNKFNRFKRNV
IKLQSIWRGYKCRNDYPKLLAERKEAEETKAISEKSDKSDETQHLTKEPI
QQPPLPPSQRRDPPDLPPGLPFDSTHALEGGVVDPPTVTITCAVGSPYSP
HRKTITEKADNMMGDLLKDTMFSDSQKEPSTDDELESVKNVGVKLKENKA
PVEVPSKPPSQPPVQPPEVKTGRSDGHLYEEIGNFESVFKTSDIEAPPEE
KKANLVKLRHKDSNDESRRQKFYRRLSFTHKDKSKSSIHLRKSREAEDFE
MITAPTSSELLQPVNVVKNTTTGITTPASHSSGHHHGSSNTPKATGLAGL
FTLTRKGSRRDTPKDKRSHRRSLTAAENDYVANGEVELEALNGFLMKKVA
DMNKPDPEKKNDSGADVTFKHALHKYHGNLLFTCANASVNRKEEILLKFN
DLVHGFQETLEQIINQADSGVSKEFSVMGVNLFRGILEEFQKNKDKLVVK
TRSNIKHVKKKRRKTAEFYEHKGHVYTFQNFNIRTYCEYCNSYIYDKGLV
CQACAFTCHKKCHSKYPKTCKGRRPSLCGPSTLFGTPMSELTSPNNPIPE
TVIKLMIEIEKRGLYTLGIYRKPGPQAAINNLKSVLTSTEAEELILEDEK
PHTLASILKLFFRQLPQPIIPFNYYDDFIRSTDLENKKEIHSTLYELIQH
LPKENKLLLERLIVHLGRVTSLVEHNKMSPNALAIVWAPCLLRASEDADP
LESLAQLPKQTKCVEILIEFQVKSRKDMLNDIQALYRAESTAGEKLDDII
QSEETDGDPEKNKENDEMKEILKAQIQNMSTERERITNNMAAISPPKTRS
LDSVDDLTDMDYHLRDSFEVLHFPEDGDHISVTRQSSVMDISNETPSTPT
STEKRHVDGNSSSFEDLSCVGTSK
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000735XLOC_000735Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001380TCONS_00001380Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR001609Myosin_head_motor_dom
IPR002219PE/DAG-bd
IPR000048IQ_motif_EF-hand-BS
IPR000198RhoGAP_dom
IPR029071Ubiquitin-rel_dom
IPR027417P-loop_NTPase
IPR008936Rho_GTPase_activation_prot
Vocabulary: Cellular Component
TermDefinition
GO:0016459myosin complex
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0003774motor activity
GO:0005515protein binding
Vocabulary: Biological Process
TermDefinition
GO:0035556intracellular signal transduction
GO:0007165signal transduction
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0035556 intracellular signal transduction
biological_process GO:0007165 signal transduction
cellular_component GO:0016459 myosin complex
molecular_function GO:0005524 ATP binding
molecular_function GO:0003774 motor activity
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1819..1839
NoneNo IPR availableGENE3D1.20.5.190coord: 1054..1083
e-value: 0.025
score: 14.0
coord: 964..998
e-value: 2.8E-6
score: 26.7
coord: 1030..1053
e-value: 6.2E-5
score: 22.4
NoneNo IPR availableGENE3D1.10.555.10coord: 1572..1791
e-value: 1.2E-51
score: 174.6
NoneNo IPR availableGENE3D3.40.50.300coord: 247..702
e-value: 9.5E-5
score: 21.2
NoneNo IPR availableGENE3D3.10.20.90coord: 21..146
e-value: 2.8E-10
score: 40.1
NoneNo IPR availableGENE3D4.10.270.10coord: 999..1029
e-value: 2.4E-7
score: 29.9
NoneNo IPR availableGENE3D3.30.60.20coord: 1517..1571
e-value: 6.9E-11
score: 41.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1797..1816
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1077..1133
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1321..1373
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1196..1221
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1881..1924
NoneNo IPR availableSUPERFAMILY57889Cysteine-rich domaincoord: 1510..1572
IPR001609Myosin head, motor domainPRINTSPR00193MYOSINHEAVYcoord: 209..228
score: 52.33
coord: 600..628
score: 25.05
coord: 265..290
score: 54.31
coord: 547..575
score: 69.82
coord: 310..337
score: 71.32
IPR001609Myosin head, motor domainSMARTSM00242MYSc_2acoord: 173..964
e-value: 5.5E-290
score: 979.3
IPR001609Myosin head, motor domainPFAMPF00063Myosin_headcoord: 182..725
e-value: 7.4E-182
score: 606.0
coord: 816..951
e-value: 3.3E-30
score: 104.8
IPR001609Myosin head, motor domainPROSITEPS51456MYOSIN_MOTORcoord: 179..963
score: 229.234
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainSMARTSM00109c1_12coord: 1524..1570
e-value: 7.5E-10
score: 48.7
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPFAMPF00130C1_1coord: 1524..1572
e-value: 1.1E-6
score: 28.3
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS00479ZF_DAG_PE_1coord: 1524..1570
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 1523..1570
score: 12.588
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainCDDcd00029C1coord: 1524..1570
e-value: 2.27202E-10
score: 57.8872
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 1045..1067
e-value: 0.002
score: 27.4
coord: 988..1010
e-value: 7.4E-6
score: 35.5
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 991..1009
e-value: 1.2E-5
score: 24.6
coord: 1048..1066
e-value: 5.5E-4
score: 19.4
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1047..1075
score: 9.487
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 989..1018
score: 7.712
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 1596..1772
e-value: 4.6E-54
score: 195.6
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 1599..1747
e-value: 1.3E-40
score: 138.6
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 1586..1775
score: 40.778
IPR029071Ubiquitin-related domainSUPERFAMILY54236Ubiquitin-likecoord: 34..106
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILY52540P-loop containing nucleoside triphosphate hydrolasescoord: 813..1013
coord: 177..707
IPR008936Rho GTPase activation proteinSUPERFAMILY48350GTPase activation domain, GAPcoord: 1593..1770

Blast
BLAST of TCONS_00001380-protein vs. Swiss-Prot (Human)
Match: MYO9B (Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3)

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 411/937 (43.86%), Postives = 605/937 (64.57%), Query Frame = 0
Query:  174 LYREKTDIDDLVALPVLNETVLLDQLCTRFCKGRIYTYVGGILIAINPFKYFPIYNPKYVNAYQNKKLGELPPHVFAIADAAYNRMLISKQNQCIVISGESGSGKTESTKLILHHLTALSHKTKATVLEKTILAAGPVLEAFGNAKTSYNNNSSRFGKFTQINYRADGVVCGAVLKKYLLEKSRIVQQGINERNYHVFYSMLAGASQTERETLHLLTPQEYFYLNQTQCYTIEGMDEVYEFARLKNSIKNIGIPSITQQRMFAVLSAVLHIGNITFRKRSFP-EDSVSVADEKIIEIIAELIQVDKQELIVPMTMRKTITRGEEFVRQYKKDEAIATRDSMAKCLYASLFDWIVLQTNHIMVSKQGRKVDKKAFSIGVLDIFGFEDFERNSFEQFCINLANENLQFYLNQHIFKIRQDEYVEEGLDWDHVDYADNSTCLNLMVGKPTGLILLLDEECSLTIGTDESLLDKFNQHHSNNTCYEMPPTREPVFSILHYAGKVKYQIEGFRAKNRELMRNDVVSVFRNSRMLFVRELMGSDPVAIYYWSILRHTIKAVSIFKKAGAARAKGQRMFEPKASVSWMKSKTPPNK--------SKALMRQLTEAEIDTTG---------QAMMRRATKVMNRRVLDM-AKRIQS----PSRMRSGLEARRTISGGMSEYARRGGL-----KQPPTVVAQFQSSLMELMDALNQSHPFFVRCIRSNAVKAPLKFEAELVLRQLRYTGMLETVKIRQAGYPVRIFVKQFVNQFRILLRAKDLDRISEDELTQMLTDLGLDTDEFQVGANKVFMRESQYQLLRDKMQQAVDRAATTIQVWY----HRRYLRKLKELEISSAIIIQKYWRGFVCRREYVYYQETRLRNRSARRIQNFWRTHEQTAARKPNKFNRFKRNVIKLQSIWRGYKCRNDYPKLLAERKEAEE 1078
            L R++ D DDL  LP L E  LL  L  RF + +IYTY G IL+AINPFK+ PIYNPKYV  Y+N++LG+L PHVFA+AD AY  ML  + NQCIVISGESGSGKT+ST  ++H LTALS K  A+ +E+TIL AGPVLEAFGNAKT++NNNSSRFGKF Q++Y   G+V GAV++KYLLEKSR+V Q  +ERNYHVFY +L G S+ ER+   L  P++YFYLNQ      +G D  ++F RLK +++ +G    T++++FAVLSA+L++GN+T++KR+   E+ + V   ++++ +++L++V ++ L+  +T RKT+T  ++ +  Y   EAI  RDSMAK LY++LFDWIVL+ NH +++K+  +      SIGVLDIFGFEDFERNSFEQFCIN ANE LQ+Y NQHIFK+ Q+EY  EG+ W ++ Y DN  C++L+  KPTGL  LLDEE +    T ++LL KF Q H +N  +   P  EP F I H+AGKVKYQI+ FR KN + MR D+V++ R S   +VREL+G DPVA++ W++LR  I+A+++ ++AG  RA+     E  A +S   +++ P +        S+ L R L    I +           +++++  +++   R   + +K I+     P  +      +  IS  + +   +  L     K+PP++ AQFQ+SL +L++AL ++ PFF+RCIRSNA K  L F+ ELVL+QLRYTGMLETV+IR++GY  +   + F  QF++LL  KD     E  ++ +L  + +D   +Q+G  KVF++E++ Q L++ + + V R    +Q W+     RR+  ++K     +A+ IQ  WR +  RR          R ++A  +Q  WR + Q        +   K+++I+LQS+ RG+  R  + ++++E+++AEE
Sbjct:  141 LPRQQADFDDLCNLPELTEGNLLKNLKHRFLQQKIYTYAGSILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYTMLRKRVNQCIVISGESGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFIQVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPEDYFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQIFAVLSAILYLGNVTYKKRATGREEGLEVGPPEVLDTLSQLLKVKREILVEVLTKRKTVTVNDKLILPYSLSEAITARDSMAKSLYSALFDWIVLRINHALLNKKDVEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYANEQLQYYFNQHIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFPHATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIVALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAE---RAEKAAGMSSPGAQSHPEELPRGASTPSEKLYRDLHNQMIKSIKGLPWQGEDPRSLLQSLSRLQKPRAFILKSKGIKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLEALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTEQFQVLL-PKDAQPCRE-VISTLLEKMKIDKRNYQIGKTKVFLKETERQALQETLHREVVRKILLLQSWFRMVLERRHFLQMKR----AAVTIQACWRSYRVRRALE-------RTQAAVYLQASWRGYWQRKL-----YRHQKQSIIRLQSLCRGHLQRKSFSQMISEKQKAEE 1056          

HSP 2 Score: 238.424 bits (607), Expect = 7.446e-63
Identity = 175/572 (30.59%), Postives = 274/572 (47.90%), Query Frame = 0
Query: 1315 NVVKNTTT---GITTPASHSSGHHHGSSNTPKATGLAGLFTLTRKGSRRDTPKDKRSHRRSLTAAENDYVANGEVELEALNGFLMKKVADMNKPDPEKKNDSGADVTFKHALHKYHGNL--LFTCANASVNRKEEILLKFNDLVHGFQETLEQIINQADSGVSKEFSVMGVNLFRGILEEFQKNKDKLVVKTRSNIKHVKKKRRKTAEFYEHKGHVYTFQNFNIRTYCEYCNSYIY--DKGLVCQACAFTCHKKCHSKYPKTCK---GRRPSLCGPSTLFGTPMSELTSPNNPIPETVIKLMIEIEKRGLYTLGIYRKPGPQAAINNLKSVLTSTEAEELILEDEKPHTLASILKLFFRQLPQPIIPFNYYDDFIRSTDLENKKEIHSTLYELIQHLPKENKLLLERLIVHLGRVTSLVEHNKMSPNALAIVWAPCLLRASEDADPLESLAQLPKQTKCVEILIEFQVKSRKDMLNDIQALYRAESTAGEKLDDIIQ----------SEETDGDPEKN---------------------KENDEMKEILKAQIQNMSTERERITNNMAAISP 1845
            +VV   TT   G+  P+     H  G   T +  G        + G    + K + S  R +T A          EL+ L+ FL+ K+ D+      +   +  +  F  A  K+  N+  +++  N  ++      + + DL+  +Q     + N A     K+ +++ +NLF+ +L+EF +   K   +     K  KKKR++     EH GHV+     +I   CE C SYI+  DK L+C  C  TCHKKC  K    C    GR+         FG  +  LTS    +P  + KL+  +E  GLYT G+YRK G       L+  L  T+   + LE+   H +  +LK + R+LP+P++ F  Y DF+R+ +L  K+E  + +Y +++HLP+ N   LERLI HL +V  L + N+MSP ALAI++APCLLR  +++DPL S+  + K T CVE+LI+ Q++  K  + +I  L  AES A  +L  + Q          S   +G   K+                      + D  KEIL  +IQ++  E+E IT  +  + P
Sbjct: 1444 HVVLEATTMKKGLEAPSGQQHRHAAGEKRTKEPGGKGKKNRNVKIGKITVSEKWRESVFRQITNAN---------ELKYLDEFLLNKINDL------RSQKTPIESLFIEATEKFRSNIKTMYSVPNGKIH------VGYKDLMENYQIV---VSNLATERGQKDTNLV-LNLFQSLLDEFTRGYTKNDFEPVKQSKAQKKKRKQERAVQEHNGHVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSHCSYTYGRKGEPGVEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAANRTRELRQAL-QTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEKQEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEELEVLLEEEAAGGDEDREKEILIERIQSIKEEKEDITYRLPELDP 1989          
The following BLAST results are available for this feature:
BLAST of TCONS_00001380-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MYO9B7.446e-6343.86Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B... [more]
back to top