Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001380 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001380
Unique NameTCONS_00001380
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length7206

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001380 ID=TCONS_00001380|Name=TCONS_00001380|organism=Clytia hemisphaerica|type=transcript|length=7206bp
TTATAGAATGTCTTCTACTAAGAAGgtcaaaaaagaacattttaaaaagc
tataaaaaGTTGAGGTATGGTGTAGTTAAACACCAATGATACCTGAAAAT
GCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGTTC
TGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAGTG
AAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATACA
GACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGATT
TGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATGCT
GTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCTGT
ACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAACA
TGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGAGT
TATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGAGA
TGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGAAG
CATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATCTT
GTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGTAC
TCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGATAG
CAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAAAT
gcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCTAT
TGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATGTA
TTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGTTA
ATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTTTT
GGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAATG
CAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCCAA
ATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAGTA
TTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAACT
ACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGGAA
ACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACACA
ATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCTAA
AGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAATG
TTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGAAA
GCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcattg
aaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTACCA
ATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAGTA
CAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTTGT
ATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGGTC
AGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTGCT
TGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATTTT
GCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACATC
TTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGATCA
CGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAAAC
CCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCGGT
ACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAATAC
GTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACATT
ATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATCGT
GAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATGCT
TTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTGGT
CAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTGGC
GCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTCAG
CTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCGAC
AATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGCGA
GCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATACA
GaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTCCG
GAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGACT
GTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTGAA
CCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAAGg
cACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATACG
GGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGTAT
ATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAAAG
ACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACCTT
GGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATGCG
CGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGACC
GCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGAAA
CTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGGCG
TGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCTAC
GTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAACAG
ACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTCAT
CAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCCTA
AGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCGAA
AAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATCCA
ACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACCGC
CCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTGAT
CCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCTCA
TAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACTGA
AAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACGAA
TTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcgcC
CGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACCAG
AAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAAAT
TTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAAAA
GAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAGTC
GACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAAGT
AAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAAAT
GATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGTTA
AGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCCAT
CACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTGTT
TACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACGAA
GTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATGGT
GAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCAGA
TATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGTCA
CTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGTGT
GCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAATGA
CTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGCGG
ATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCCGA
GGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAGAC
GAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGAAT
TTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataCGC
ACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTTTG
CCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCCAA
AGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTATTT
GGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAAAC
TGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTTAG
GAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAAGC
GTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAACC
ACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCAAC
CGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacTTG
GAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACATTT
ACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGGAA
GAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAGCT
ATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCTTT
AGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTTGA
TTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAGCT
TTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATTCA
ATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacgaaa
tgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGGAG
AGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCTTT
AGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAGTT
TTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACACGA
CAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACGTC
AACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTTGT
CGTGTGTTGGTACGTCAAAGTAATCTCCTGCTAAAACGtaactttaattt
ttctaaaggaTCTTCTACTCATTTGTCTgtctttcttatattttttcaaa
caatgtgttctttttttaaaagataatttaaattattttagaaattcTTC
TAGTTTACCCTTTCTCTTCTTTTTCGGTCCTTGTTGAATTCGAGTCGagt
catccaaaaaataaaGCTTTGTTACGTCCATTGAGGCACTAGCtgacttt
tttaaagaaatatttcaaattttttgtcttttgactTTTTTCCAGGGTTT
CATCGGGCTCATCTACGGGGTTGGAATAGAAAATAATAGggatataaaat
attttttaacattttaaaaagACATGGCTTTTATTACAAACTTCGttagt
gaatttttaaaaatcaattttttttttcatttttttttttcaaagtcagT
CAGAAAGATGTTTTTTATATTGTGAAACAGAAATGATCAAATAATGAAGC
TACATtgtaaagaaatcaaaaagaaagcaAAGGTTGACTAAATGAATACA
CGTGTTTCTATGTAAGAATAATGAAAGTTTGAGGCCAAATCATCCTCTCA
GGACCTGATTAGTCATCCTATCTATACTCGATTtagaagaatattttttg
aagaatttttaatgattcaatttAATAATTTAATGATAATAGCAACAgta
aataaatgtttttttgttattattgttatttttaacagtttttttttttg
ctacaaAATCGAAATCAATCTTCTGCCTGTGTACGAAATTTCTGAAAGCT
CAATACTCTGAATTCACAGTCTGTGCCGTCATAATGAGTTAAAccttttc
aaattgaatttgagtttttatttttcttgtaaaatataaatgaaTGTCAT
GAAAAAGGGTTTTAAAGAGGTACACTTATGGTAGATCTAGAATGTGTTAA
TATAAAAGATTTTAATTCCAAAATACCTAGATGATTTTCAAAACCAAACC
CACTtactttatgaaaaaataattatctaCACACCTTTTTTTTCCTTTGT
ACATAGCTCAATTTTCATGaggttgtttgttttttgaaacTATAAAGAAA
GCGCTCAGTGGGTTTTTATGCGCGATAATAGATAGTCAGTAGGGAAGGCT
AGTTCGTGCAGAATGTTACGCTTATACACGCGTCTGTTCTCTTTAATAGG
GACATACGAAACTTATCagaaatttgttttataaagaAATACATTTATTA
AATACAATAATTTATAACCACTTTACAATTTACTTTTTGTGTACTTTTTT
GCTAATTTTCAACGAGATTGAAAATAGCAAAATCAAGATTTAACTTTATA
GGTTAC
Run BLAST on NCBI

protein sequence of TCONS_00001380-protein

>TCONS_00001380-protein ID=TCONS_00001380-protein|Name=TCONS_00001380-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1924bp
MPGMEATIKEPTSPLPVLYPITVYTTILTPDGKVKTEVNVTIKTTVSDAI
QTVLDSFSIVSSVELFDLCEVYSEFGVFPTDPDAVFENLRSLSYSEYPLA
VQKAWTAGAPNGLDRSNMSEDELSEKSPMNNIQSYRLYLTQKSDQLEGGR
DVKVTWLDGLDKKIPPEAWHFDPLYREKTDIDDLVALPVLNETVLLDQLC
TRFCKGRIYTYVGGILIAINPFKYFPIYNPKYVNAYQNKKLGELPPHVFA
IADAAYNRMLISKQNQCIVISGESGSGKTESTKLILHHLTALSHKTKATV
LEKTILAAGPVLEAFGNAKTSYNNNSSRFGKFTQINYRADGVVCGAVLKK
YLLEKSRIVQQGINERNYHVFYSMLAGASQTERETLHLLTPQEYFYLNQT
QCYTIEGMDEVYEFARLKNSIKNIGIPSITQQRMFAVLSAVLHIGNITFR
KRSFPEDSVSVADEKIIEIIAELIQVDKQELIVPMTMRKTITRGEEFVRQ
YKKDEAIATRDSMAKCLYASLFDWIVLQTNHIMVSKQGRKVDKKAFSIGV
LDIFGFEDFERNSFEQFCINLANENLQFYLNQHIFKIRQDEYVEEGLDWD
HVDYADNSTCLNLMVGKPTGLILLLDEECSLTIGTDESLLDKFNQHHSNN
TCYEMPPTREPVFSILHYAGKVKYQIEGFRAKNRELMRNDVVSVFRNSRM
LFVRELMGSDPVAIYYWSILRHTIKAVSIFKKAGAARAKGQRMFEPKASV
SWMKSKTPPNKSKALMRQLTEAEIDTTGQAMMRRATKVMNRRVLDMAKRI
QSPSRMRSGLEARRTISGGMSEYARRGGLKQPPTVVAQFQSSLMELMDAL
NQSHPFFVRCIRSNAVKAPLKFEAELVLRQLRYTGMLETVKIRQAGYPVR
IFVKQFVNQFRILLRAKDLDRISEDELTQMLTDLGLDTDEFQVGANKVFM
RESQYQLLRDKMQQAVDRAATTIQVWYHRRYLRKLKELEISSAIIIQKYW
RGFVCRREYVYYQETRLRNRSARRIQNFWRTHEQTAARKPNKFNRFKRNV
IKLQSIWRGYKCRNDYPKLLAERKEAEETKAISEKSDKSDETQHLTKEPI
QQPPLPPSQRRDPPDLPPGLPFDSTHALEGGVVDPPTVTITCAVGSPYSP
HRKTITEKADNMMGDLLKDTMFSDSQKEPSTDDELESVKNVGVKLKENKA
PVEVPSKPPSQPPVQPPEVKTGRSDGHLYEEIGNFESVFKTSDIEAPPEE
KKANLVKLRHKDSNDESRRQKFYRRLSFTHKDKSKSSIHLRKSREAEDFE
MITAPTSSELLQPVNVVKNTTTGITTPASHSSGHHHGSSNTPKATGLAGL
FTLTRKGSRRDTPKDKRSHRRSLTAAENDYVANGEVELEALNGFLMKKVA
DMNKPDPEKKNDSGADVTFKHALHKYHGNLLFTCANASVNRKEEILLKFN
DLVHGFQETLEQIINQADSGVSKEFSVMGVNLFRGILEEFQKNKDKLVVK
TRSNIKHVKKKRRKTAEFYEHKGHVYTFQNFNIRTYCEYCNSYIYDKGLV
CQACAFTCHKKCHSKYPKTCKGRRPSLCGPSTLFGTPMSELTSPNNPIPE
TVIKLMIEIEKRGLYTLGIYRKPGPQAAINNLKSVLTSTEAEELILEDEK
PHTLASILKLFFRQLPQPIIPFNYYDDFIRSTDLENKKEIHSTLYELIQH
LPKENKLLLERLIVHLGRVTSLVEHNKMSPNALAIVWAPCLLRASEDADP
LESLAQLPKQTKCVEILIEFQVKSRKDMLNDIQALYRAESTAGEKLDDII
QSEETDGDPEKNKENDEMKEILKAQIQNMSTERERITNNMAAISPPKTRS
LDSVDDLTDMDYHLRDSFEVLHFPEDGDHISVTRQSSVMDISNETPSTPT
STEKRHVDGNSSSFEDLSCVGTSK
Run BLAST on NCBI

transcript from alignment at sc0000010:749360..782620+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001380 ID=TCONS_00001380|Name=TCONS_00001380|organism=Clytia hemisphaerica|type=transcript|length=33261bp|location=Sequence derived from alignment at sc0000010:749360..782620+ (Clytia hemisphaerica)
TTATAGAATGTCTTCTACTAAGAAGgtcaaaaaagaacattttaaaaagc tataaaaaGTTGAGGTATGGTGTAGTTAAACACCAATGATACCTGAAAAT GCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGTTC TGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAGTG AAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATACA GACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGATT TGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATGCT GTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCTGT ACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAACA TGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGAGT TATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGAGA TGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGAAG CATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATCTT GTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGTAC TCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGATAG CAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAAAT gcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCTAT TGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATGTA TTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGTTA ATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTTTT GGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAggtaattttagatt tattctACACAAACAGGATGATTTCTTAGTCATAGCTATGAAAATATTGG TAATCATAATACCTCATTTTCTTAACGCTAATGATATTAGTTTTATCAAT TCTAATTTTTCTCAGGCTTTTGGCAATGCAAAGACAAGCTACAACAACAA CTCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTG TAGTATGCGGGTAAGAAAAATTacaatattcaattttaatcAACTTTAAC AGATTTTACATATCTAAAGTATTCCAGAAATCTCAAAAGTCTTGTTTTTA ACCAATATTGTGGTTTTCATAGTGTCTGTTCTGATGTCATAGCATACTAA AATATAacatatttcttttatattgTAAAATTTAGGGCTGTCCTAAAGAA GTATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAA ACTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGG GAAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGGT ACATGTCATAATTATAAAGTCAAGTTGATCAATTGTATCCAGTTTATATC AATATAAAGTGGCAATTTCATTAGTAAAATGCCTCCACTGAAATAGAACG TGACTTGATTTGGTATTTTATCAGCTTTTCCTGTGGTTttcattttctat aaaaaaagtttaaaaagagtAATTTACAATGTTTTTGGTTATTTCACTTC CTTATTTAGACACAATGTTATACCATTGAGGGGATGGATGAGGTCTACGA ATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGAATTCCATCAATTA CACAGCAAAGGTAATGTTTGATAAGGTTATTCTTAAATTTGGAGTATCAA TTAACTAATCATATGCCAATCAGAAACTTTTTAACAAATCCAAGGACTTa ccatatttcatttttaaacagATTATggtttaaatttgattttattctaC AGAATGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTT TAGAAAGGTAtcattttaattatattttttatgcaGAACCAGGCTATAAT TTTAAAAGCATCAAAGGCTAAACCCTGGGGAAGGCAAGGGTCACTCAGAC AAAAATAGGGTATTGGGAAGTGCTGCTTGTCAGGGTCACTTTTCCAACGT CTGAAAATTTCTGACAGAGTTGCAGATCTTCGAAATTTCGAAAGTTGTTT CTGAAAGAGTTAACTTTTGGTTATTCCCTCCACTCATCAAGGTTGGTTTT AAGCTAGAACTGATGTTATGtgtcatatttattttttacctaGCGATCTT TCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcattgaaatcatt gcaGAGCTCATACAGGTGCTTCATTTATTTCATCATCCTTATGCCATTGT TTGATTATTATATTCAATACTATACAACGTTCTGTTTCTATGTTACTCTA TCTTATGTTCTTTTTCCATGGTGGAAAGACTCCAATGGCAATGAAGAAAG TTTAATTTTCTAATAATTTATTTCAACATTTAGGTTGACAAACAAGAACT GATCGTACCAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTG TACGACAGTACAAAAAGGATGAGGTAAATACATCATCTTTCAGAGGTCAT CCACTACCCAATAGTATCAATTTTTAGGTAACACGGGTAGatgaaactta aaattttaaatctttccAAATAGATCTTATGCAGTACCAAAATGTGATTT TGTTATTTCTTATTACTTTTCAGGCAATTGCCACCAGGGATTCAATGGCA AAATGTTTGTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCA TATCATGGTCAGTAAACAAGGACGAAAGGTTGACAAAAAGGTATCTAATA TTTgattatttaaaagattttctacaCTTGAAAGCCCATAGTCCAACCTT AGCCAGGAGTTTTATTTAAGGCTGACGAACGGCGATTTTTGCAAGGCACA AAACTAGAAATCAAAATTTGGTGGTCTTACACTGGGTTTGATAAGAATTC ACTGGCCTAGATTCTAGAATTCGCTGGAGTCACAGTGGatttttcattcg ccagcctATCGAAAACCAAGCAAAACCTCTGCTTagcatttttttttctg atgcGTACAATATTTCTTGTTGATCTTTCTTTATGCAACTCTACAGCGGA ACCTGTTGAACATTGAAGCATtatactttgaaaattttgattttactttt gtaGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagattttg agaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAATCTT CAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGTAAAGTGATT TTGTATGTTAAGCTTGTAAAGCCACAATTTTTAAATGTAATTTTTATGCT TAACTGAATGTATTTATCTAATTAATTTTATTGTTAGAGATGTGCATTTT GAAAGACGTAAGAACTTTAATGAGACGTAAAAACCTTCTATTTTCACTAc caaaaacaataatttttgaGTACTCTAGAAATTTGTAATAGGGTTTTAGA AAGTTATAATTTAATgagtaataaaaaaaatttcgaaatgttttccaata gaaattttttctctttttctcctCAGGATGAATATGTAGAAGAAGGCTTA GACTGGGATCACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGAT GGTTGGAAAACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGGT ACTGAATGCTTTTCTAGTTTATTGAAAGGGTTCTTCCTTTATTTTGAAGG AGAGAGGTTTGATGGGAGGAAGTCTATTCAAGCCTTTCTTCCCTATTTAT TTCGTGTCAAGAAGGCTTTATTTTAGCAATTCTACTGTACTGGtttgctt aaaatttcttattgtaaaagctcaaaaaattaCGAACTTTTTACTAAAAC TTGAAGGAAGGTGACCGTATTTTGGAGTCAAAAGCGTTAGATTTTAACCC AATTTTGGAGGGttagttatttttttaaattttgtgagaACTAGATTTGA CAAAGTGACAGGGTTAACTTAATTCCTTTTCGCCCATTAAAATGAGTGTT CTAGACAAATTTTTACCTTAAATGTATCTATATATTACCTAATTTAATAG CTTGACAATCGGTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACC ATTCCAACAATACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTT TCTATATTACATTATGCTGGAAAAGTCAAATATCAAATTGAGGTACGCAT CTTCTTTGTTGTAAAAAAGCAGTATTTAAGCTTAAAATCTGccattatat ttttttcacaaaaacattACTTTGGCtaatagactttttcataaattacg tcacgaacatcacttgcctcgtattcaaacaatttccataaTGATCACAT CTCATGAGACACAtgaaatccgctgggagttaagttatcaccatggcaat aatttcaaaacgaggcaagtgatgttcgtgacgtaatttatgaaaaggtc tattattctTTCATTACAgtcgtttttatttatttgagtcTTAAAATCCC ATGTTCAATTCAAATTCTAGAATTTTCAACTCCTAGAAATAGGCTATATA TTGCATGAGCTTTAAAAATTAACTCTTATAATTATGTTTTTAGGGATTCC GAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGA AACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGTAAGGAATCTTTTGG CGAATTGGTCAACTCATTCGAAACTTTCCAGAATATCTTTACAATTGTAT CATTTTAGCGGTCAAACTACCTATTATATATTAACACCACTCATTATTAA ATTCCCTTCTTTAAATCTTTAGGCTCTGATCCAGTTGCGATCTATTACTG GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG GCGCTGCTAGGGCCAAAGGTAACGTGTTACTTTTCTGTATTACTGTTCtg ttactattcaaattttatcaGAATGTTTAatttaaaacaatttcttttcg GAACATCATCTCAAGAATTATTCATATTTTCTAGGACAAAGAATGTTTGA GCCGAAAGCATCAGTCAGCTGGGTAAGTAAAAGTTATTGGAATTTTAGCA TTGGAGTTGGTTAAATTTTTGCACTTACAAATTCTTTGGAACCTAGAGAT GCCTGAAAATATATTAGCTACTTAGTTAAAAAACAATTATCACcagcatt tttatttcaagcagtTCCAACTCAACAGGAAAACTAAGCTCTTTTAATTT TACGTGGTATCCAtaaattaataatttttctgttttatttttcagatgaA GAGCAAGACTCCTCCGAACAAGTAAGCGTTTGAAATATTAATCATAAAGT AGTAGCCTAGTGATGATTTCAACTTATCTAATGATCTTTGGCCTTTCATC ACAATATCCTTAAAAAAACTGTACATATCCCCAGCAAAGTATCACCTTAT TCTGGATTaagataatttttctttaatacCCTGACTGTTAATTTGGCATG ACGTCGAATTGTGATCATTCCCAGGGAAATTTAGGCTAAACCAAAgtgat aatattttattttacttaaaaTGTCATATTGTTTTCGAAATCTTTCTTCA AATCAGTAGAACTTGCTcgttttctttgctttaggAGTAAGGCATTAATG CGACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAG GCGAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAA TACAGGTTTGTCACTCTCTTATTTAGATTTTCCtatatttgttttatttg ttttactGTTTTCAGTGTCCTTAAAACATAGAACGGATCCTACTTCTGGT tgtgtttttaattttaaattcgttGCACCTTTCGGTCCCTTTCACGTCGG CCCTTTTTACGTTAAAGctcaaatttttctatttttggccCAGGCCTCAA TTTAACTAATTAATAAGTGCCgatgtaaaaagggccgattaaGTATATta tgttttcctgaaataaGTGAAGGAATTCTTGGAATTAATTGAAATCGATT ATTGCtgtcattttcataaaaaatgtgctctaaattttcaataaatgacT ACACATAATGAATCAAGAATCCATCTTTCATCATAATCTCCACACAAGAC CAAATTTGTCTTTGTTTAACAAATATGTCACTGAGCTTTTCTTGAACGAA CGTTCCCTCCTTTAAAACGTACTCACGTAAGTTTCTCACCAAATTCCTTT TTCTATAAAACaaacattgaaatattttactttGGATCGTCAATCCGCTC AGATCCACTAAATCCTAAAATTTATTCTGCTAATCTTTAATCAAACAAAC CGTTAGAGctggaaaaagttttcaaaatttaggaaGGAGAGCGGTTCTTT TCTTTCTATCTTTACAATGGAAGGCAATACTCTTCCTCGTAGATGTTTAA CTTTCGTTCCAATCATAACATCTACTCCTCCTAGGCCAATACacattctt ttataagaaagtaacaattaaaaataatctttgaaccctttttgattttt tatctttaagagaattaaacctaaaaatgcTCTTATCTTCAGTATCCTGG GAGTATTTTGGCGTGAATTCTTACGGAATTGCATGTTCTAGAGTCCGCAA TGCCCTAGAATATTCTCAAATCTTTGGGCTCGAAATTCTTGCTTTGTTCT TATGTATATGTATAATCCTTCTAGTCCATTTAAGCTTATGTCTTCTTAAA ACACGAACGAGAAAAGCCCAATTTGAGAACGGTTTTTTAAACAGAACAGA CGTTTTAAGACATCTTATCTATTCTTGTGTATCCGTTGCTTGAACATGTT CAGTGGGAGGGACTTCCTTCTCGACTCTAATTTCAAAACACTTTTGTGGT CACAGTCCTCTCTTTGCTCGTTCGTTGAGACTTTTTATGTTGTATGTGAT TAATTGGTTTGTTGTGTTATTAGATGATTAAAAATGTCTAGTGAGAAAGT GTAATCACAGAGATGTATGTTTCTTTATGGAGGGAACTTTGGATTATCTT TACGTTGATTgacgaaatatatttttttcatgttATAATTTTCTCTTGCA TCTTTTTTTTCACATATTCCCTAGTGGCAACCTGTGcttcaaattacttt tttttttcggcaatttgtttttaattgcAGTCATCATGCTTAGTATAATA TTCAGTTAATCTGTTTTTTATGATGCTCGTAAAAAAATAGAAGAGttgag ttattttgatttgatttgatgaagattttttcaatGTTAATTTACGTTTC AATCTGATTTTAATTCGTATGGAATCGGTCGAGTGAAAGTGACATTATGA TAGAATTATATATTTGGGTCATTGATGGATGGTTAATTTTCAGTTTAGTT TGGCTGAAAGcttctgttttttatcttcaaatgttttgttttttgttatt ACTTTCTTTTGGCAATGAGTAAGGGGTTAGAAATCAGAGGAAGTTGATAA ATTAGAATATTACAATTTAAAACATTATACTTCAAGGATTTTAAAATTAC ATAACTTGTTTAGTATGGTATATGATGCAGTatatgatgatggaagaaaa cTTTGTTTCAAAATTACGTTTGTGGTTGATAATCATTATAGATATTTTTT CGCAGGTTTTTTCGCAAGAGTGTTGTCTTCTTTCCTCTAAGCTCCCCTTT AAATTTTTCTCAAGTTGCGAACTTTAATTCATTTGTCGCTTTGTATAATT TTGTAAGAAGCTGTGAACGAGGAGTGTCCTGAAgtctttcaaatgaaaaa ggaagACTGGAAAATAAAtgttcttcatttttgaaaaaaatgttatgTTA CTATGAGTCAAGGATATCGGAGAGGATACTAGCGgcaacttttcattttt tcatttgccTTTTTTTAATGCTGTCAATACCATTCGATATCCCTATCTAT TGTACGTTCATTTAAAGTGACATTTATCAGTCAATCTTTTATGTAATCAA AAAAAATGATCACGAAGTTATATCGTTAGTATCATTCTCTTAAACCGTGT ATCGTAATAGCATTTTAGGTATCATCCTGCTATAAtctttttttgtgtgt tttcagCATTATTTGGCGTAATTTCGCTTATATATAGTTGTTCGTTGTGT TTTTTTTCCAGTTAATTGATCTGACGTTCAAATGGATTTTAATTGAGATG CCAAGGAACGGTTTCGTTTCTTGGTTCCTCGTGCTTTATTAATGACAATC TGGTTTTGATCTCTTACTGGCGTGTTGTTTGGATGTCATTTTCGTCTGTT GTTCTTCTCTTCAATTTTCTATGCCGTGGTATATCATttcagttgacgct ctctaattccaTTTCCATggagaattggattttcatcgaatatgTGAGAA TATCAAAGAGTAGAGTCGTTTATTGATGTTTCGTGTTGACAGTGGCTTTC AATGTTATTATCGAATGGAACATATCGAGAAGTAGaatgaataaaattaa agaGCGCTTATTGTAGTCAAGCTATTGCTATATTACGTTCACCCATGCTT TCTTGTGGCTTGGTATCTCTGTTTGCGTTTTTGAGCAACACGTTTAAATA AATAAACCGATGTAATTAATGTGACGGATGCAAACGGAACATCTAATTGG CTACTAAGGTGCAAGCGAAATAATCTTACGTTTGGCGTATTTCTTAACTT TGGGAAGACTAGTCTGCAACACAtgcttttcttttaaaaggttGAATCAA AGTATACAGGCTATAGATACATAGTAGTTGACGACTAAATGTAAAAGAAA GTAGGCAATGACGAAGGTAGTTGGAATAGGAATCAGTATTGGAAAGCCTA GTCAGAAAACAcaattttgttatataaaggttGAAAGTATGCAGGCTAGA TGATAGTCGACAACTAAATGTAGTCAATAATTAGGAATCAGTATGTGTGT TTACACGTTGACAATAACTCAAGCCACTGTACATAGCAGATCTTTATTAG TGCATTGTAGTATTATATtaacgagtttatgtatttgcaacTTTTGGGgg cggtaaagtgactgaagcgattcgGAATAACTcacagttctgacccgcaa aatcgaggatggTAAAAAATGCTGAATTACCGTTGTCCTTAGTCTCCGTC ACAGAAAAACGCTCATACTCGCTTTTGACCAATAAATATAACATAATCTG GTCAAGAAAAAGCAGATCATCAACATATCTTATGGATTTAAGAGTGGAAC GAAGAATTCATTTTAACCACTGATCTTAAATGTAAATTCACCGTTTAAGA ATGAAAACATCGAACATGAACACCTTCATCATCTAGAGTACCGTGATGAT CTTGAGGAAGCAAAGTGTTAGGTCGCCCAACGCCCGAAAGATTTCCTTac aaatatcttacaaaaaTCTAGTAATCATAAGCCTGGATTTGCTTGATAGT ACGTCTAATAAAACCTCTCCCattgaagtataagcccgaagggctagaat cgaatctccttggtaaggtttgaagccaacaaatcctaccaaagttgccc GGCCTAGCGCGGCCCGCCTGATTTTTACACAAAtggcagattgaaactaa aatttaccactaaatttcgaaaaaagtatcacttgaaaacaaaagaattg ctagattcaatccgtcgtcaaagatatggcgcatattttaaggcttcact ttttcttgcctgagaaaggttagagattcgattctagccattcgggctta TACTTATGACCTCTCCATCCATCTTTAAAGATGTAATTTGCAGGTTATCT TGTTTTTCCTGCCCTCCTCGTCATAATctgttttttcatcaaaatctcaA CCATTTTAATCTGCATCTCCAATACAAATAGATCAGACGTGTGCATTATC TTTTACTACCGTCTGCTCTTTTGTAAATGCAACTCTTACTTAAGTTCCTA CTAATATGTTTTTGTTGAGATTTGTTTTTTGATGTTTGGATTTCTTAGCT GATATtctttctttgtgtttttttgtaTGATGTGTCTCCTTTTGTTTACG TAATTGTTTGGTTGGTTCCGTTTTGATTCAGTTTTGAACGCTCTATGGAT GTCTATCTGATGGTTCTACAACTTGTGTCTCTATTCCTTAAACTTTTAAA CAATATTGATCCAAAGTTTTATTCTTGTATCCTCTTGACCATTTGTGTAT CAGTAGTTTTTAGTTTATTTTGTCAActgtttttcttcttatttttgttt GTCACTTTTTACATGTTGTTATAACGTTTTAAGAGAGTTTCGTCACTACA CTGTCTgaacgaaaaaaattgtataGAAGAAGTAACAAGAATTACAACCC CGTCCCCTGCGTATTATCggtttttttatgcttactggaTAGCGCCAGAT AATACTCTGGCATTGTCTGCTTTTtatctggcgtccatcagtaacgtaaa taaagcctgggatacacggagATAAGGTTGCAAGTAAAGTATAATTCTGC ATCATACGAGACGTTCTCTcggaaatttgaaattgaacagaagtagcaaa aaattgtttatttctccttttccaaaatttgttattttgctCTCTACTTG AACTATGAGCCCACGGTAAGACGTCAAAACAGTGTTAGATAGATGTTCAC AGGTGAATGTGTATAATACTATTATTCCTTCGAGGAATAGTATTTCAGTT ATTGAACATACGTGAAAATTTCTTCGTTGAATTTGTTGTTTCAAGACATT CTGATTGACTccaatgaaaaaattattcgtgtttggaaattttttttatt cgagTTTCtgcaaagaaaaaacaaaggtTCGAGTAATAGAGAAAATGTTG TGTACATAGTGTGATACTACGGGAAAtattttattacttttcaaggttga ctgtttttttttgtgtgtaTATTGGTCAGAGTTTATCAAATTGACGTGTG TCTTGGAAAAAGATCGATCAAATTTCTCAATCGATGTGCCAACTAACGAA CGTTTTGTAATTTCAattcattttattattctctTCCCTTTCGATCATGA ATTCTGATGTTTTTGTCGACATGCGTGTTTGTGTGCGAATATGTGTGCAT TGTTTAAGGTCACTTAAACGATAAGCTGTTTTGCTTTCGTGGAAAATATG GCCCGCTCATTCACGTTTATTTTAGGCAATTATGACCTGGCATGGGTCTG GTTTGAAATGTCTTTCTTtttcagtgccgtagcaactgggggggcaaggg ggggggctatgccccccccaataattttttcaaaaatagttattttgcaa aatgcaaagtttttcttttttaatttgtcataattgtctttgaAGTGCAT GTtatgagtgcattttcaagcaatctagagctcaaattttcaaaattccc ccccttgggccaaaccatggttcgccctcgcggtgtcactaaacttcagc cccctcaatatgaaaatgcttcctacggcactgtttttctaggaaagact tctttttcgatgtattttgaAAGCTGGATTTAAGTAAAGGAAGTAAAGCT TCGGCACTTAGTCCCCcgtttatttattattttatatttttttagagTTT TCATTGCCTCTGTGTTTTAAGTAATCTCGGACCTTGTtatattttaatta tcattaagGAAAGCTAAATGAGTCAATTAACCAACTTGCTttgtttgtaa agttttgaTCTCTCTTTTATACTTTATTAATGATTTAGTGGCGTGGGAAA AGTTAGAAATTGAGTTGTAATGTTGTCGAGCTTTGATGATTTTGTTCACT GGACTTTGAAGGCTGTTTTTTTAGATTCTCGTCCTTTCTGTTTAGAATGA ATTTCTCAATTATTTTACCTTCTGATCATAAACTACAATGTTTAGAAGGC TATGaaataatagaaataaaatAATAGAATGGAAGAAATCAGCTCGAAAA TGCAAATTAGTGATTGGAAAACAGACCTAACTACTGTCACTACTGTATTG TTCAGGTTGTAGAAAGTTGTATTAGATTAGGGATCTGCGAATCTCCTTCG TATTTGTGTGTCAGGAGTTTATTTTGCGCAACATTTACATTCAAAAATCT CTCAATTTTTTCCCTCATTACATTGTATTGTATCAGCTATAATTTAtatg aaaagtgaaatttcatAAATAAACATTGTAAAAAAATGTAACCTCACATT GCTGTCATGAGACAAATCATCACAACGGTGGTGTATACAACACCAAAATC ATCGACCATACAAACTACTTGTGGATGTGGAAACCCATCAGATACGGTAA GTGGCTACAATCTGTGACTAATATTGTGACAAGAATTTTCTTCCTCCTAG TATCAGTGTTGATGGGTGGAAAGGCTGCCACCATGCTCAGAAAAAGCTCA CATCAACACTGATATTAGGGTGGaagagatttttcaagaaattgccctat attttgtcactgattgtagatgcCAAAGTCTGCATCACTTCTCTTATGGG TACTATAGTGATGCacagtctccataactcgaacacgcacggggggaaca caaatttgttcgagttcaaggagttatggagtaaggtttataagggaTTG CTAACTGAAAGGACGAGAAAaattgttcgaattaaggagacatATAAGTT ACAGAGGTTCAAGTTAAAGAGAAACTActttatcttgattttttttggat atcGGATCTGGTACAGCAGACAAGCCTTTAGCAGAATTTTACATGCGACT TATATGGATACTTTTTATGCTTTTTTACTTCATGCTTTTAAATTCCTTGG GTAGGTCTCTTATAGTTTTAAATGGTATACACTCtttttacactcttttt tataagaaacagtaTAGTTTTTATGatgctcggctgttcttatttttttg cactttgagcctcaaattgttcttatcctgttcttattaaTAAGTCATCT TGCAGTATTTAATTGTAATTGAGGTACTTTACACCTACTTTTTACTACCC TTACTACGCTACGCTTTACTACGCTTACTTTGATGTGTTTCTGGCAAGGT TTTTACGATATTCCACCATACTTTACCGTTCAACATATACTTTGTGCATC ATGCATACTTTTTACTCACATGTGACTAATGTGATGGGTAAAGACTTTGA GCACTGATGAAAACAATCCGTACTTAGTTCTTAGCTCATAAGCAGATTTC ATTACAAATGCTAATTTCCCTCTATTCTTTCACAAAATACGGCTAATGTA ATAACTTTCGTCTTAATTCAATGATTTACGTGTTTCAATTATCTCGCATT GAAATTAACGCATCTTATCGATGTTTAATTATCTTTCTTGTGAAAAGTTT TACGAGCATGGCTCATAATATGCGTATTTCCTTCAGGGGTGAGTTACGGA AAATCGGGCTTTGGGGTTTTCTATGGTCCTTGATGGTTTTTTAACTGATT TTCATCTTCTTTAACAATAAATGCTCTCATGGTACATATATGTTTGGGCC TTCATGAATTGCAATgtcattttaaaaagttttgataatATACTTATGGC ACAGTCTACTTATTCATTTTTCAAGAACTCTTTCGATTCAAAATAGTATC ACAGTTGTGAAATCTTGCGTAATAATGGTAAGACAAcagtaattattttt aaaaaaatctcacaTTATTCTgtcttttaaaaagattttctgattgACAT TGTCAGCATTGCTACTTGATACCTTTTTAAGGCCCTTGTCactctatttt atttttaatctattTCCAGTAAGTTTTTCGAGAGAGGCCAAGTTGTTGCT GTTTTTTAAAGATCCGCCCCAAAAATGAgttgaagttttttttcttaaga TTGCCAAAGTTCTCATCAGGAATAGGGGAAGTAACAATCCTCTTAATATA ATGTAATTTTCTTACCAAATCGAAAAATGAACGGTCTTCAATCAAAAACA AAGGCTGGGATGGCTGGACTACGGATGACTAAAGTGAAGTGATCTCgatg attgaaaaatattttttgcttgcaAAATGAAGGGGCCGTGGTGCAACTCT GTTAagagtttttgtattttgaattgagaattgagaaaaaaaaatcaaaa tcaactaatcattttcttttcagaGTCCCTCAAGGATGCGTTCTGGTTTG GAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGAAGAGG TGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGGTATGGTTTT CTCTCACATTGTCTCCCCTTGTCATCCCATGTAGTAGTTGTAGTAAGGTT ATAAATTTACTTGAAAATTATCATTATTGAAGAGACGTTACCTTTTGCTA CCGTGGATCACCAAGTAGACGTCTTCTTCTATTTAAAAATCATCCTTAAA TTTTTCTGCATATTCCTTCGAGCTCATTTGGTATTCTTTATAGCCTAATT AGAATACACGACGGATGTGATGTTGGTGTTGAGGGCGTTACTCTCCTTTT AGTTTAGAGAGTCTTTGTCCAACTTAgtctacacaatatattggcgAACA ACACTTGACAATATAATTTGAGGActgtaatgtacgaagtaaacgaCAGG CTCTATTTTAAAGGGTATCTTTGTGTAAACAACCCCTCCCCCCTATATTG TTGAATTATTGCAAATAATCCAACAATATATTACCGGCACAACTAACCAA TATATTGTTTAACAATATATATNTGCAAATAATCCAacaatatattgccg gcacaATTTACCAATATATTGTTTAACAATATATATTATGTTGTAGCCCT ATAGACTATAATTTTATCATGAGAACGTTCTTTTGTTTCCAGTCTTCACT GATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTACGTT GTATCAGGTCAAATGCCGTCAAGGTGAGTTGACGAATCTTATTCTGGTGC ATTTACAACATTGGTTCCCAAACCGTTCCACGTGTCAATGCTCCTCTATT AAAATGAATTTGTTTGGTATCCTCTAATACAatcttcagcaaaattcctc TTTGATTCGAGATTGTGCTTACGATGAACGAATTTCTGACATAAGAAATA AATCTTTTGAGCAAAACCTTTTTCGTTAAAAAACTGAGAGAACTTTTAAA TGAAAGATAACCCTGTACCATGgcctgatgtttttttttttaatttacta CCTAAAGACATGTTTTAAGTACTCATTACTGAAGATGCTCACTGCCCCCA CAACGTGGTAGCAATTGAACCAATtcttattattaattttttttcatagg cACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATACG GGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGTAT ATTCGTTAAGGTGAGTCAGAGTTTCGGTTGGAATTTTCACCTTTTAGGGT TTTAGGGTCTCTCTCGAAAaccatgaaaatcaaaaaacggTCGCTCCGAG TGTCCCTTCTTTTACCCATTTTTCCCTGTGAGGGTCACTTTTTCGTTTAA ATTTAATCTCTTTAAAAAGTAAGGGACCAAAGGTCTGACTTTTGCATACC CAACATTTTCATCCCTATACTCCTTCCTCGGGGTTTCTTCTCTAGGGCCA TTCCGAAAAATTGTCAACCACGATTCTATGCCCGATTAAAAGGTGCATGG GTCATGGAGCTCCTAAGTCCCTACTGACGGTATCCAATCAAAAATGAGTG TGACGTAATGTACCCCTTACTCTGGAATGGCCGTCTATCGCTTGGAAAAT TTTAAAGCGATTGCCCctttgaattttgataatggCGCTCTCATCCTGAA CAAAAGTTGTGATCATTACCACCAGTGCTAGCTCTGTCACCACAGGTTTG AAATTTATGTCACGTTAAACTTAGTGTAAGAGTGTGTTAGCAACTATATC TGTTCATCTGTTTCCAGCAATTCGTAAACCAATTCCGTATACTCCTACGT GCAAAAGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGAC AGACCTTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTT TCATGCGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCG GTTGACCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCT GCGGAAACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGGTAA TTTTCAAGGATTTCGCTTTATTATGATGTATGAGTAGAGAACGCATTTTC ACGATTCGGGCTACTCTAAAGTCCAACGCAAGAAAAACCATGAAGCTTGT TAAATGTTAGGGAGCACCTCACCAAACGGGATGTTCCAACTCGTTTCttg gtgagttccactttgacgattttctgaaaaacgaACCCTTTCAAGTGTCC TGGCGCAATTCGATTTTTCCCTACTGCAGGAACGAAGCTTAAAGTTGTct cgcaaatcgaacgtttggaGCCCGtaaaaaagtcgcaaagtggaatagat gttaattgcgtagaaagaATGCGGGTGGTGTCTAGTATATGCTAGCCAAA TGCGTCTTTTTGGTCTTCACAATAACAAGTTTTGATCTTCTCATATAATA GATGTATTCACCTTTCTGACACTGCAAATCTACTGAAACATTTCCATATA AACTATTTTATTCGCACCTTTTTCACAAATGTACAGAAATATTGGCGTGG TTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCTACGTA ACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAACAGACT GCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTCATCAA ATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGAGTAAGCTTTTT TCACTGGGAAACTTTCCTTGATTGATCAGATTCGGTACGGGTTTCATGTA ACTCTTGACTAGGCTGCTAGCATCATTCTGATTCTAACAAAATCATACCA TGATCTACGAGAAATCATTTCCAATAAAANTCTAGGCTGCTAGCATCCTT CTGATTCTAACAAAATCATACCATGATCTCCTACGAGAAATCATttccaa taaaaaaacttttacataCATACTTTTCTGATCCTTTTGGAATTACTAGT CATTAACTGTTCCTGATTATTCCTTTTTAGCTATCCTAAGTTACTAGCAG AACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGGTACCCTAGCTATTTT AAGAGgaaatttcttctttatttatTCTATTATGTCGTACCATGTTCAGC ACATTCAACACCTCAACTGTACATAGCTTGTTTTCTTAACCAGCACTTTT CTTACCTTGCACCTAACTAAAAAAGAACCAGCAAACTTTCGTTGACAGTC TTGGTGCATATAACCCCAACCATACCATTTAATCTTTAAGTAGGAATCAA TCGCATTTTGATAAATTAAAGACCATATTTTCCGAAagcaaatttcttca aaattatcAAACTTACTTGCAGCGAAAAGTCTGATAAAAGTGATGAGACT CAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTCA AAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACCC ACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATGT GCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGTAAGGGCC TCTCGTATTTGAACCCATaaaaaacatctaaaattttgtttacTAATTTT CATGCATGCTTCAATCATATAAATACATACAATTATACACATGTTCATTC TTAAGAAagtccaaaaaatttaaaaacacgGATGATGGTACTTCCCGTTC ACATNActcattgggctcttccagaaaaagtccgttcattgggggtggag gatgaagaattgtccaggggtattgaaaaaaagccaaaaaattgcaatgt ccaggggggtaaattccaatgtccaggggtaattttttgtgtccacgggg ttgatttgatgtttgtccaggggttgatttgatgtttgtccaggggtata acccgtgtccagggggttaaaaatcaaaatgtccaggggtaattcatgaa aataataatatatcctccaccccccatgaacagattttttctggaagagc ccattcttaagaaagtccaaaaaatttaaaaacacgGATGATGGTACTTC CCGTTCCCATAACTATTTGGCTATAAGACGGTTTTCCATTGAGCTTAATT TCCTCTCGGGTTGAGTTTTTCTTGGACTGAATTTTCATCTAgttaaattg cttaaaaaagtcaGTTACAAGCCAATTTGTTATGATGTAACATCATCCGA GATAGTAAAGAGAACATATTCCGGCTTTTCACTAAGAAAGCAatacaaaa atgatttgatATTGCAACGAATCAATTCGCCAAAGCATGATCGCATGtta taaaacaacaacaaaaaaacacatTAATGGAATGAATTTAGCCACACACA TACACATACATACAATCTACTAATGGTTAACATTCGATAATCAACAGCAC GCTTCTCTTCACCCACCCTCTCCTATTTTCCAACATGGTGTTATCACAAt aaggccttttcataaataatTTTGAGTGCAACCATTGCCTCATTTTAAAA CCGTTACCAAGGGAATTAAATCCCTtgagtttttaagtttttcttttata aatagagtaaatttctatgaaattgaaaattaatttgaaaacgaggtaaa tgttgctcgtgacgtaatttatgaaaaggtctattataggccatttcaca gtcgcaaagcgtaatgggtaatcagtaccactgcgcgctaataacgactt actattggtctaaagttttgaaaaaaattgaagatttttgcgtctagcca acgggaagccgtaatggaggcgcaatcagtcctgattacccatgatccat ttcgactgtgaaatggcctattctCAGATCGATTGTgctcatattggttt cggaacgtttcgaatcaagaaaacgaaGCAGCTTCGTTCCGAAGTTtata gtggagcgaaaccgttttgatctgttttgctttgtgaCGTCTTCTTTTTT AACGTTTCCAATTTTGACGGTCACactttcggaaccgtttcgtttcggaa caaTATGGAACCgcaacgtctgaacatggtctcatATCGGCTTCCGTTAT CAGAGCGtggtggtcctgattacccataattCCTTTCGACCGTTAAATGG TCTATCGTGCTTGTAATgtaagaaattttcaagaattaGATCATTCGCAA ACTCCCGTGTGATTTGATGGGATTTAATTCTGCGAATTGAATTCATTCAT TTTACGGAAATTAAATTTTCGAAACGTtgtaaaagaagaaatataaGAAT CTGATCGTCGTAGGAAGAgggtttggtcaatttttctgATCGCGAAAATT TCTCACATTAAAAAATTACTCGTTTACATTTTATTAATGTAACGgttata cagttgacgctctctaattcgacgttctattattcgatatgGCCGAACAT TCGATAATTTTGAAGAAACACTCATAAACGATGCTCTGcttttcgatacg ctcccttattcaatgaaaatccaattcttcttaaagatcgaattagagaa tgtCAACTTTAGTTCGATTATGGATTTTTAGAACTCCTTATATCCAAGTT TACCAACCTCTTATTCCAGGGAGAAGGCGGACAATATGATGGGTGATTTA CTGAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGA CGAATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaag cgcCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCA CCAGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGG AAATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGG AAAAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAA AGTCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAA AAGTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTG AAATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTG GTTAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGG CCATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGT TGTTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGGTAAG TTAATGGACAAGGCTGGAATGGGGGCTCATTTATATTGTCTGTATTTCAT GTTTCGCCATTGTTCCTAGGGCCCCTTGTGACACGGAAATCGTGTATAAA ACGCTAGATGGAGCTTCTAGCTTCCTAGCTGAAGAAAATAATGTGCCATC TATATAAGTAGAAAACAGCTCGATACCGGCCATTTGATCAATCAAGAGCA TTCTCTCCCCTCCCCGTTCCAGCCATGTCAGAAATTCGTGAATGATAAAT TGGGTGTTTTCAGTAAAAGATTCTTTTAGCGAATTGGACCACAGTGCTTG TTTCCTCTCGAAATGACGAAACCTCATTGGTTAAAAGGTacatcaaatgt tttttttcgttGTGAAGAATTCGCCACCTCATCAAACGCTACTCGTCTCT TTCAGACAAACGAAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATT ACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATG AAAAAGGTATGTATGACACACTGGACACGAcgaaaaacctcaaaaaaccT CAAGAAAACCTCATTCGAGTCTTTATTTCTCAAAATCGaaagttagctaa attatgacttcataaaagtgcaaattatgacgtcacttgaCTCTAGctcg atttttcaaaaaaggattttcgagttagctaactctgTTTCTTTTTTCAC AAAGCCTCGANGAAAAAGGTATGTATGACACACTGGACACGAcgaaaaac ctcaaaaaaccTCAAGAAAACCTCATTCGAGTCTTTATTTCTCAAAATCG aaagttagctaaattatgacttcataaaagtgcaaattatgacgtcactt gaCTCTAGctcgatttttcaaaaaaggattttcgagttagctaactctgT TTCTTTTTTCACGAAGcctcgagaaaaaaatattcgaGTTAATTCTAACT TTAAAAttctaatttaaaatttctaatccttttttaaaaatgaaaaattg agttagagtcgagtgacgtcataatttagctaactcgaaaattgcttaat cgaagttttctaactcgaagattccgGGCCTCCATTTTTGCTTAcagatt tatttgaaaatcaagTCAATAAAAGTTACGGGCCACTGCGGCTGATTTAT GACGTTATCAATGAATAAACGTTGACTTTATTTCAAACATTTACACTTGT ATTCAACtgtaatctttataaattttagGTAGCAGATATGAACAAACCTG ACCCTGAGAAGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCG TTACATAAATATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGT CAATGTAAGAGTTTTGAACTTGGAGTATATTTAAGTTTTTATCAACATGT GATTCGCTTGTCCCTTAAACAGTCAAATGTACTTTGTACTTAGGAGCTGA ATTTGCCAATTTAATCTCAGTCAGTAAatctatgattttttttaatttta agtatTAAAAATCGCCACTGAAATTAAACGATCTAGAATCTTGAATAAAT ATTGTGGCAAGAATTCCCTCCCCCCCTAGTATCAATGTTTATGGTTGGAA AGGCTGCCACCATGCTCAGAAAAAGCTCACATCAACACTGATATTAGGGG GGAAAtggatttttcaagaaaagatTTCTTGATGCTTATACTATGTGATT CCCAATTTCAGCGCAAAGAAGAGATTCTACTGAAATTCAATGACTTGGTT CATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGCGGATTCGGG TGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCCGAGGAATTC TGGAAGAGTTCCAAAAGAacaagtaaattttttcaagtgTAAAATTCGAT CCTATTTGAATTTCCATACAACCTTTTCCATTATCGAGATAACTTgattt aatcggattaattttcacgaatttctcgaattttttgccttttttctcAC AAAAGTAAATCTCAAGACATCACGTGAAATTGCTGACTCGCAAAATTTAA CCCACCCTAAATTGCATATTAGATTCTCGGTCAAGAATACACTGtctgtt ttgtattttttacgAAAAATTGCTCCAGAAATTTTTGTAATTGCTATAGT TCGTGAAAATAAATCCAGAAAACTTCGCGAAAATTGAACATCCATTTCGT TTTGAGATCTAACTGACCGAGAAGTTTTTAATTTggatcaaaagaaattt ttatggAGTAAACCCCTTTAAATTATTTCACAGGTAGAAACTACTTcatg attttctgattttaattttcttttgttgttttttaggGATAAACTGGTCG TGAAGACGGTATGTACTATGTTTCACtcaacacgtttttttataagaaca aactatataagaacatctagATTTGGATTTAATAACATTTGAAGGATTCA TGGACTCTTAAAATActcaaattttttagaaaatggcacaaaatactcac aaaatggtgaaacgaagaacattttaagaacattttaaggcttaaaactg aaatgttaagaacatacgaaagcttcaaaaattttggacgttTTTATTAT GTTCTAAATCAAAAAATGTACTCTATCTTCTTTATTGAAAACTACTGGAT TgaccatattttcaaaattgttttgatcaatttttaaatCGTTTTCATGT CTCATGGAAGATGGAAAACATGCGCTGACAGAGATAAatcttatttcttt atttttctcagAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAA ACGGCTGAATTTTACGTAAGTTATGTTATCTATCTGGTTGTATCATCTTC CTTGCTACGTCGCCGGGGCTATACTCCCCAacccagcaaaaaaaaattat tgataccTAATCCGATCGAATggaaattgattgaaattcaatttaacata aatcttttaatttgtattttttatgttgttttttttcaggagCACAAAGG ACACGTTTatacatttcaaaatttcaacataCGCACTTACTGCGAATATT GCAATTCCTACATCTACGATAAAGGCTTGGTTTGCCAAGGTAAAAAGTGT ATAAATtccttgaaaataatatttttacgaAAAAATGGTCCCATGAGAAA AGCATGTTTTGGTATACTTTCTATTATTGAATGGTGGCAACTGggatttt tattatattattctTTTATTCCTTTTTCTTGTAACTTTTAGCTTGCGCGT TCACTTGTCATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGG AGGCGACCTTCACTTTGTGGCCCTTCAACGGTAAGCGTTTTGcagtgttg caacttttccgTCTGTAGACGGATATCCGTCCAGTTGAGATACAAATATA TCATTTCCCTCTTGCCAGTAAGAGGGTTTTGGTTCAAATGACCATCTAAT CCTAAGGTTTCCGTCCATATTCACAAAACCTAGTTGCAACACTGATTTTG AGTAATCTTTTTCTTGCTAGAATGTCTCAATGTTCtttcgggtgcctaat aaactggggggggggttcaaaaTAAAAGGGTGGagtaaagattttttcaa atttgaataaacgGAGGATCTTAATTGCCGGAGTGTAATAATTACTTATA TTGTACTTCTGAAAGCCCTAAAATTGGGGTATAATATAAATATAGGCTAG AATCAGGTTGATcagagcaaaataagagacttgTGAGCTAACAAAGTGTT GTTCTTGGCGTGCGATAAATCTAAGATTTGTGTATACGGTTTTAATAATG ATGCCTAATGTGTTTTGATATCCGCTAACATagctaaatatttcaaaaat taaaaaacggggggtcctaataaggtctaCGGAGGGGTGgaataaaatcg aaaaaatattaGGCATCTGAGAATATCTGTATTTAAGAATGGTTTCCAAT CTAACATACCACTCTTCGTTACTTTCCCACCAAACTTAAATCTTTGATAC TCTGAAGAAATCATATTTTTGTACTTTACAATTTCATTTATTATTATACT CATTTACATTCTTTAGCTATTTGGAACGCCCATGTCAGAATTGACTAGTC CAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAATCgaa aaaagaggtatgaaataaaacttttattatGGGCTTTATATATTTCCAAt tcgtgatatgcaccactgcaatgtcttctgacattacgtcatggaaccaa tagctcattggttggaagtgacgtaaaagcagtcaatacgtcactttcaa ccaatcagctactgggtggaacggaagacattgcaatggtgcgtATCATG AATAAGAAGTTACAGTCAACTCTCACTAATTCGGACTTGTCCAGGAgatc taatttgttcgaattacagaaagattcgaactatggagaggttttttttt taatctcctGCTGATGGTAACCGAAAGTTATATCGAATTATCGAAAGATT CgagaaaagaagtttgaataaGCGACATTTCTCTGCATCACCAGTACACT GTCGATTCGTTTCACAATTTTCACGGGAGTCAAATCACAATGTTCATTCA ACCTATTGTTTTTTCTACCCATTCATTTAGGTCTATACACGTTAGGAATA TACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAAGCGTCCT GACGTCTACCGGTAAGTGCAAACatttataaaaaaccccggtccggaaag cttttgtttctttctattggTAACAGTTAAGAGCTTTCGTACGTCATAGC TTTGCATATTTTTAATCACGTGACTTGAAAATAAACTAGTCTCAAAAGTC GAATATGACAACGTggtcaaaaagtatgcaaattgCAACTTGTCTTTTAT CGGACAACAGAAAACTTGACGATAAAGTTGAAACAATTTACCAGATCCTG TTTTTTACAATGACTTTCGTTCGGACTTCATTAAATAGCTTGTAATCAGA AGTACCTAAGACAAAAATATTAGACTAGAGTATACTTCTGACTGGAATTG GCTTTGCgtttatttttgatgacgctgtaGCCATGTGTTTATCAATCCTT ACGTCAAAATCCGTGTATGAGATGGGGGAGAGGGGATTGAGTTCGAGTTT AACAGGGTAAAATGATATGAAAAAGTCTGAAGTCGTCACATGAACAGACA TGCTACGTTCAAATCAACCCTTGTTAACTAAAACCCAATCCTCTCGTAAG ATGTTTCACGTGTACAGTAGAGTCTTCATAACTCGCATGTCTCctcaact cgaacaaattttctggTCTCTTCAGTTGATAATGCCTAATAAACAAATCT CAATTACTCGAAACTTCCataccgtaaatcaccgattaagcgccccgctt gaattatcgccccgctcgaataagcgccccccatttagttaaaataattt tataagcgccccgctcgaataagcgcccccctttgaataagcgcccccct ccAGGGAGGGGCACTTATTCGAATTGGTGGCATAGGCTAATTTCCGGGAT AAGAATTTCTCTTCAGATGATTAACAGtcgaaaaaaattaacttgTTATT GAAGAAGATGAAGACGAGGACAAAgatattgttattgattgaataagata ttgtcttaaaaagaaaaaaacgattaagaataaaatgatagaaattgtca attggatttttcttttattNCTTCTCAACTCAAGCAAGACTTGAGCGAAA AGTTTATCGTCGGTATAATTGCAGTATATTTAACAGGAACCACAAGGCcg atttctctttttctttttccagtgACTTCTGCCATCAAATTATTAAGTTA AGTTaagttaagtttaagcagattccgaatttgttgatatacgaatttct gaaataaaaaaataagcgccccgcttgaataagtgccccgcttgaataag cgcctccctcagagcctgaaaaattaaacaagCGCCCGGGTgcttaatcg gtgatttacgCTAATCCGAATAAATTTCTGtttcccgtgcgtgttcgaga tatggagactccactgtattaaGCTCTAACGTCTAAATCTGCATGAAAAG GCTCAACATCCCAGGGTAGAATGATATCCAAACGCCTGAATTCGTCACAG GAACACAATATTGACGTTCGATCAACCCTTGTTAACTAACACCTTCAAAC CTAGTGTCTTAGgtgttttaaacttttaaaggtcttatttttacataagt gttcccgtttcatatcagacacatgtaaCATATAAGGGCAGTATCTGcat tttgttatattatgctgatataaacaaaaaaatgtttttcctttcctctt tctgaccaatcttgctccacatccgtgtcaattcaatataaaaaagcttg taaattaaaattgacgagtaagcatactatatcactcttattcaaaaaca aaacctttagaaTCTATTGTTTATTCTCATTACAACTGTAGAAGCGGAAG AATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGAAG TTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTACGA TGACTTCATACGATCTACAGGTAACTACGTTCTCTTTCGTTTGGAGTTCC ATCATTTCTATGAGATATGAGATATGAGATATGAACTATGAGATCATGAT TTTGNTGTTCCATAATTTATATGAGATATGAGATATGAGATATGACATGT ACTTAACTTTCATAAAGATtaaagaaaagttttatttcttttcaatactc gGAGTTGCCTGcttaccccggggggggggcacgcgatttcgaaaattttg ccgcgcaaaatctgcttttcaaaatcgtacccttacaatgcagttcaata tggctaaAAAGATACCCTGTCAGTGCATTTCCTCTTGATTTACCCATCCC CTATAGTGTACtgtatttctcagctgtaaatttgtgtgaaaaaagaagct tgggaaattttctgttttaaataaaaactgagaaaaatattcttgtcagc tgtaattatcatacaatagaaactttttcaaacaaacgagaagtaaaaat ttttttctttatcaaattattttgattttgttttaaaattctacccttgc agtgcaatctcacaggaACACACACTTACAGTGCATTCTGGATGCTGAAA ACCcaacccttaagcgcggcacatgacgtaggccagatcatatgagtgtc CCCCCGGGCTGCTTACGCactcatcagttgattagaaacttactttactc tccataGTTTGCTTGATGATTTGAATTGGGTGTTCATTCATAAGCGATga actttttattcatttttcatttttttagacTTGGAAAACAAGAAAGAAAT TCATTCCACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAAT TATTATTAGAAAGACTTATCGTACATTTAGGAAGGTGAGAAGGATATAAG TtctcatttttttggaaaatagatTCCAAATTTCGGCATTTTtcataaag atataaaaaatggGCTTATCTGTTTgttgttatcttttttccgtCTAAGA AGAAAATACTTAATCACTGATTTTGATGTTCATGGTGAAATATCATTGTA TTCATTTCTATCTTTCGAAAGTAGTCTTCGGCTGGAATTTCAAATGGTCG AAAACAATTCCAACGtttatttcataaaatcttttttctataGACTGGGA CCCAGAATGTTTACATTGAGGCCAAACACTTTTAGTTTTAGAGTTTGTAA CGAAAATAAGTACTACTCAATCCTCAATgattttaattatttgaacaCTG GATTCTTTTTTCCTTTCAGAGTAACTTCATTAGTGGAGCACAACAAAATG TCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTC GGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAAAACAAACAA AGTAAGAATATCTTAGGTTTTGCATCAGAAATTCCTACATAACCAAATAT ATGCAGTACTTTGACACAAAACTTTCAGCTCTCTTGCCGTCTATCGACTT AACATTTAAAATTAAGGTTCTATAATATTATCTACTCGTTTTTGGAACCA CCCACTCATCCTACAGGTTTAGAATACcttcctaaaatatttttttttct tcattgtaatgaggcccccagcggaccttcaattcacgcaatcacgcaat tttttttcgaaattcacgcattcacgcaaattttcctcgagtttcacgca ataatccgatttttcagaaatcggaaagtattttgtgaaaaatcggggaa acattggaaaatcgagaaaactgcacataattggtggaaaaaagggaaaa ttcacgtattcacgcacaaaatagcccagattcacgcattcacgcaatcg aAAAGTACATTTTcccgttcacgcaagttttttcaattcacgcattcacg ctttttttttttaattttcacgcattcacgcattcgaaaagtacattttc acgttcacgcaagtttttttaattcacgcattcacgctttttttttttaa ttttcacgcattcacgcaaccaaaaatgcccattcacgcaatcacgcaaa ccgcGGGGCCTCTGTAATATCAATCTAGTACCGGTCTCCTTTTTTTAGAT GTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGGAAAGATATGCTG AATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCT GGACGACATCATTGTAAGTATTATCGATGAATTTGTACTTTAATggttta aattttgcggatttctcggatttgggtgtcatccgccaaattaaggccga ttggaaatttggaaagattGAAATATCTTAaattaaaacttcaaaatgtc aAGTGAGCtcctttttgaatgtttactggcatcttAGGAGCGCTAATAAA GcgaatttcaacaaccaacatgcatgatttggccGTAAAAGGCAAACAAA ATCGTGAAGATATTGTCTCTCAATCGTGCCACcggcgaaattaagtcccc gcggaTGAGCTCAATCGCGAAATCTAATCCCTGTGAAACTTTATTCCATT TAAATATGCGTTTATAAATCTTCTGACTTccacatcaaaacaaacactgC CTCGATTTTTTCAACAAACCTATGTCGATACATAATTTCGGTATATAATT TAAAATCAAGTGAGAACTTTAATTTGCTTTTCTTCAGCAATCGGAAGAAA CAGATGGCGATCCCGAgaagaataaagaaaatgacgaaatgaaagaaatc ttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGTAAGAGTGCGTGCA ATTCAACTCAATTCTAGAGCAAACATTCAATGGACCAACCCCTAATGGTC GATTCAtacttaaaagaaaaaaacgtaccATCTTCATGATGTTACTCGCT ATTATAACTCACTCTGAGGGCATTGTAgtgtatttgacgtcaattttgct GGCATAAATGATAGCTAACCGGGCTAAATACAATTTCAGATTTTGCTTTC TAAAgtcaatattttgttttgaaaagtagaaaaaagcATTCATCTTAATT GTCCATAGAATGGACCCTTTATTGTTAAGTATGCCCTCTTCTTCGACTAA GACATAAATATCACTGGCGGGCCATAAATGAACAATCGCGGGCATAGCGT TATTGGTATATTTAAGGTTGGTTTGTATAATAAGAGAAGGATTTTAAAAC AACAAATGTATTTTTTGAGAACGATAGTTTACTTAGCCTGACCAAAGCCG CTGACATCTCTTAAAATATAGGCAAATGTTGAAAGCTAACTTTGTGAtat attttgcttttatttccGCCAGGGAGAGGATCACAAATAACATGGCCGCC ATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGGA TATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAAG GTATGTGCTGATGCTCTGATTTCAGTATTTTGTATTTTAGCTTATTGGCT CTTTTTACGTCGCCCCTTATTAGCATGATTATTCCGTCATTGGTGTAATA ACGGCTGATGTAAGAGATCGGTATTGAATTAGGGCCGggttaaaatggaa aaaatttagCTTTGGTGTAATAAATGCCGCCAATTATGGGGACGATGAGG TATGTAATTAACGCCATTAACCTTGTTTTTCggtcaaattttttggatga aattgttaccttattggtatatattttcgcgtgttacaaattttcgcggg tacttaatttcgcgagttttttggtcaattttcgcgaaatttaatactgt ttaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaatcagtctttttcttgct ttatattccgaatcgcgaaatttaatacacgcgaaaattttccagaagtc tgcaatcgcgaaatttaatacacgcgaagcacgttttttcgaaaaaattt tgcgattcgcgaaaatttgtaacacgcgaaaatatataccaataaggtag tcTAGTATGCTATGCGACATAGTCAGATAAAGTAAGAAATAGGAGAAAGA ACAACAAATTGATATTATTCCTTAACAATAATGGTATAATACATACAATA CCTATATTTCTGTATTACACGATTGATTTACATTGATTTCTCTACCACTT TTAATGAACGAATTTGTTCTGATATTGTTAGCTCGTTTGTGTAAAGCTTC AATTACTTTTTCAAGTTGATGATTTATCATATATACTTATTGATTAATTT CGattttctctgttttttttttctattagatGGTGACCATATTTCTGTTA CACGACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCG ACGTCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGA TTTGTCGTGTGTTGGTACGTCAAAGTAATCTCCTGCTAAAACGtaacttt aatttttctaaaggaTCTTCTACTCATTTGTCTgtctttcttatattttt tcaaacaatgtgttctttttttaaaagataatttaaattattttagaaat tcTTCTAGTTTACCCTTTCTCTTCTTTTTCGGTCCTTGTTGAATTCGAGT CGagtcatccaaaaaataaaGCTTTGTTACGTCCATTGAGGCACTAGCtg acttttttaaagaaatatttcaaattttttgtcttttgactTTTTTCCAG GGTTTCATCGGGCTCATCTACGGGGTTGGAATAGAAAATAATAGggatat aaaatattttttaacattttaaaaagACATGGCTTTTATTACAAACTTCG ttagtgaatttttaaaaatcaattttttttttcatttttttttttcaaag tcagTCAGAAAGATGTTTTTTATATTGTGAAACAGAAATGATCAAATAAT GAAGCTACATtgtaaagaaatcaaaaagaaagcaAAGGTTGACTAAATGA ATACACGTGTTTCTATGTAAGAATAATGAAAGTTTGAGGCCAAATCATCC TCTCAGGACCTGATTAGTCATCCTATCTATACTCGATTtagaagaatatt ttttgaagaatttttaatgattcaatttAATAATTTAATGATAATAGCAA CAgtaaataaatgtttttttgttattattgttatttttaacagttttttt ttttgctacaaAATCGAAATCAATCTTCTGCCTGTGTACGAAATTTCTGA AAGCTCAATACTCTGAATTCACAGTCTGTGCCGTCATAATGAGTTAAAcc ttttcaaattgaatttgagtttttatttttcttgtaaaatataaatgaaT GTCATGAAAAAGGGTTTTAAAGAGGTACACTTATGGTAGATCTAGAATGT GTTAATATAAAAGATTTTAATTCCAAAATACCTAGATGATTTTCAAAACC AAACCCACTtactttatgaaaaaataattatctaCACACCTTTTTTTTCC TTTGTACATAGCTCAATTTTCATGaggttgtttgttttttgaaacTATAA AGAAAGCGCTCAGTGGGTTTTTATGCGCGATAATAGATAGTCAGTAGGGA AGGCTAGTTCGTGCAGAATGTTACGCTTATACACGCGTCTGTTCTCTTTA ATAGGGACATACGAAACTTATCagaaatttgttttataaagaAATACATT TATTAAATACAATAATTTATAACCACTTTACAATTTACTTTTTGTGTACT TTTTTGCTAATTTTCAACGAGATTGAAAATAGCAAAATCAAGATTTAACT TTATAGGTTAC

Coding sequence (CDS) from alignment at sc0000010:749360..782620+

>TCONS_00001380 ID=TCONS_00001380|Name=TCONS_00001380|organism=Clytia hemisphaerica|type=CDS|length=231000bp|location=Sequence derived from alignment at sc0000010:749360..782620+ (Clytia hemisphaerica)
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
ATGCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGT
TCTGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAG
TGAAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATA
CAGACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGA
TTTGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATG
CTGTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCT
GTACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAA
CATGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGA
GTTATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGA
GATGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGA
AGCATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATC
TTGTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGT
ACTCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGAT
AGCAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAA
ATgcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCT
ATTGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATG
TATTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGT
TAATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTT
TTGGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAA
TGCAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCC
AAATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAG
TATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAA
CTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGG
AAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACA
CAATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCT
AAAGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAA
TGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGA
AAGCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcat
tgaaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTAC
CAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAG
TACAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTT
GTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGG
TCAGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTG
CTTGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATT
TTGCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACA
TCTTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGAT
CACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAA
ACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCG
GTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAAT
ACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACA
TTATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATC
GTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATG
CTTTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTG
GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG
GCGCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTC
AGCTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCG
ACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGC
GAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATA
CAGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTC
CGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGA
CTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTG
AACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAA
GgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATA
CGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGT
ATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAA
AGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACC
TTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATG
CGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGA
CCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGA
AACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGG
CGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCT
ACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAAC
AGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTC
ATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCC
TAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGCG
AAAAGTCTGATAAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATC
CAACAACCGCCACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACC
GCCCGGTCTACCCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTG
ATCCACCGACTGTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCT
CATAGAAAAACCATTACGGAGAAGGCGGACAATATGATGGGTGATTTACT
GAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACG
AATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcg
cCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACC
AGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAA
ATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAA
AAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAG
TCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAA
GTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAA
ATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGT
TAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCC
ATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTG
TTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACG
AAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATG
GTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCA
GATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGT
CACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGT
GTGCTAACGCTTCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAAT
GACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGC
GGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCC
GAGGAATTCTGGAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAG
ACGAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGA
ATTTTACgagCACAAAGGACACGTTTatacatttcaaaatttcaacataC
GCACTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTT
TGCCAAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCC
AAAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTAT
TTGGAACGCCCATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAA
ACTGTCATAAAACTCATGATCGAAATCgaaaaaagagGTCTATACACGTT
AGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAA
GCGTCCTGACGTCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAA
CCACACACGTTAGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCA
ACCGATTATACCTTTCAATTACTACGATGACTTCATACGATCTACAGacT
TGGAAAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACAT
TTACCAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGG
AAGAGTAACTTCATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAG
CTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCT
TTAGAATCATTAGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTT
GATTGAATTCCAAGTGAAATCACGGAAAGATATGCTGAATGATATACAAG
CTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATT
CAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgacga
aatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGG
AGAGGATCACAAATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCT
TTAGATTCTGTCGATGATCTAACGGATATGGACTATCATTTAAGAGATAG
TTTTGAAGTACTGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACAC
GACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCGACG
TCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTT
GTCGTGTGTTGGTACGTCAAAGTAAATGCCTGGAATGGAAGCCACCATAA
AGGAGCCAACATCACCACTGCCTGTTCTGTATCCAATAACAGTTTACACA
ACGATCCTTACACCAGATGGAAAAGTGAAAACAGAAGTTAACGTTACCAT
CAAGACCACTGTTTCAGATGCTATACAGACTGTCTTAGATAGTTTCTCGA
TTGTATCAAGTGTTGAACTCTTTGATTTGTGTGAAGTGTATAGTGAATTT
GGCGTATTTCCAACAGACCCAGATGCTGTGTTTGAGAATCTACGTTCTTT
GAGTTATTCAGAATACCCACTTGCTGTACAGAAAGCATGGACTGCAGGAG
CTCCAAATGGCCTTGATAGATCAAACATGTCAGAAGATGAACTCAGTGAA
AAATCTCCAATGAATAATATACAGAGTTATCGATTGTATTTGACTCAAAA
GTCAGATCAATTAGAAGGAGGCAGAGATGTGAAAGTAACTTGGCTAGATG
GTTTAGATAAAAAGATACCACCAGAAGCATGGCATTTTGATCCCTTATAC
CGTGAAAAGACTGATATTGACGATCTTGTTGCTTTACCAGTTCTTAACGA
GACTGTCCTCTTGGATCAACTTTGTACTCGGTTTTGCAAGGGTAGAATTT
ATACTTATGTTGGTGGAATATTGATAGCAATAAAcccttttaaatatttt
ccaatttatAATCCAAAATATGTAAATgcttatcaaaataaaaaactggG
TGAGCTGCCACCTCACGTGTTTGCTATTGCTGATGCTGCGTATAATAGGA
TGTTAATTAGTAAACAAAATCAATGTATTGTGATTTCTGGAGAGAGTGGC
AGTGGTAAAACTGAAAGTACTAAGTTAATTTTACATCACTTGACTGCTTT
GAGTCATAAAACGAAGGCAACTGTTTTGGAGAAAACGATCTTAGCTGCTG
GTCCTGTTTTAGAgGCTTTTGGCAATGCAAAGACAAGCTACAACAACAAC
TCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTGT
AGTATGCGGGGCTGTCCTAAAGAAGTATTTACTTGAGAAATCACGGATTG
TCCAACAAGGCATCAACGAAAGAAACTACCATGTTTTTTACTCAATGTTG
GCCGGAGCAAGCCAAACTGAAAGGGAAACCCTTCATCTCTTAACCCCTCA
GGAATACTTCTATTTAAATCAGACACAATGTTATACCATTGAGGGGATGG
ATGAGGTCTACGAATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGA
ATTCCATCAATTACACAGCAAAGAATGTTTGCTGTTCTATCAGCTGTACT
ACACATTGGAAATATCACGTTTAGAAAGCGATCTTTCCCAGAAGATTCAG
TATCAGTGGCTgatgaaaaaatcattgaaatcattgcaGAGCTCATACAG
GTTGACAAACAAGAACTGATCGTACCAATGACAATGAGAAAAACAATAAC
CAGAGGAGAAGAATTTGTACGACAGTACAAAAAGGATGAGGCAATTGCCA
CCAGGGATTCAATGGCAAAATGTTTGTATGCCTCATTATTTGACTGGATT
GTGTTACAGACCAATCATATCATGGTCAGTAAACAAGGACGAAAGGTTGA
CAAAAAGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagatt
ttgagaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAAT
CTTCAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGATGAATA
TGTAGAAGAAGGCTTAGACTGGGATCACGTGGATTATGCAGATAACTCAA
CTTGTCTGAATTTGATGGTTGGAAAACCCACTGGTCTCATTCTTCTACTC
GATGAAGAATGCAGCTTGACAATCGGTACTGATGAAAGTTTGCTGGACAA
ATTCAATCAACACCATTCCAACAATACGTGTTATGAGATGCCACCAACCA
GAGAACCTGTATTTTCTATATTACATTATGCTGGAAAAGTCAAATATCAA
ATTGAGGGATTCCGAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGT
TTCAGTTTTCAGAAACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGCT
CTGATCCAGTTGCGATCTATTACTGGTCAATTTTGAGGCATACCATCAAA
GCAGTTTCCATATTCAAAAAAGCTGGCGCTGCTAGGGCCAAAGGACAAAG
AATGTTTGAGCCGAAAGCATCAGTCAGCTGGatgaAGAGCAAGACTCCTC
CGAACAAgAGTAAGGCATTAATGCGACAATTGACTGAAGCAGAGATCGAC
ACCACAGGCCAAGCAATGATGAGGCGAGCTACCAAAGTTATGAACAGGCG
GGTTCTGGATATGGCTAAAAGAATACAGaGTCCCTCAAGGATGCGTTCTG
GTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGA
AGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGTCTTC
ACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTAC
GTTGTATCAGGTCAAATGCCGTCAAGgcACCATTGAAATTCGAGGCGGAG
TTAGTTTTACGGCAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAAT
ACGACAGGCTGGTTATCCTGTCCGTATATTCGTTAAGCAATTCGTAAACC
AATTCCGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGAC
GAATTAACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCA
AGTGGGCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTAC
GTGACAAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTG
TGGTATCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAG
CGCCATTATTATACAGAAATATTGGCGTGGTTTTGTGTGTCGACGTGAAT
ACGTATATTACCAAGAGACGCGGCTACGTAACAGGTCCGCACGGCgtatt
caaaacttttggaGAACTCACGAACAGACTGCAGCTCGGAAACCGAACAA
GTTTAATCGATTTAAAAGGAACGTCATCAAATTGCAAAGCATATGGAGAG
GCTACAAGTGCAGGAATGACTATCCTAAGTTACTAGCAGAACGTAAGGAA
GCCGAAGAGACAAAAGCGATCAGCGAAAAGTCTGATAAAAGTGATGAGAC
TCAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTC
AAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACC
CACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATG
TGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGGAGAAGG
CGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCG
CAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGG
CGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTC
CCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGAC
GGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTC
GGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAA
GACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGC
TTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAA
GTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTG
AACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACG
ACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACC
AAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGA
GAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGACAGCG
GCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAA
TGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCTGAGA
AGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACATAAA
TATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATCGCAA
AGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAAGAGA
CGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaagaattt
tctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCCAAAA
GAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACATGTAA
AGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACACGTT
TatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCAATTC
CTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACTTGTC
ATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCGACCT
TCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAATTGAC
TAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAA
TCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGGACCA
CAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAGCGGA
AGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGA
AGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTAC
GATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTCATTC
CACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTATTAT
TAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGAGCAC
AACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATT
GAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAA
AACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGG
AAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGC
AGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGCGATC
CCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGCTCAA
ATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGGCCGC
CATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGG
ATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAA
GatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTC
AAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACG
GCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000735XLOC_000735Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001380-proteinTCONS_00001380-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001380-exon-sc0000010-1491911889:749360..750396TCONS_00001380-exon-sc0000010-1491911889:749360..750396Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:749360..750396TCONS_00001380-exon-sc0000010-1510915933:749360..750396Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:749360..750396TCONS_00001380-exon-sc0000010-1575043694:749360..750396Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:750525..750619TCONS_00001380-exon-sc0000010-1491911889:750525..750619Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:750525..750619TCONS_00001380-exon-sc0000010-1510915933:750525..750619Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:750525..750619TCONS_00001380-exon-sc0000010-1575043694:750525..750619Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:750795..750957TCONS_00001380-exon-sc0000010-1491911889:750795..750957Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:750795..750957TCONS_00001380-exon-sc0000010-1510915933:750795..750957Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:750795..750957TCONS_00001380-exon-sc0000010-1575043694:750795..750957Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:751169..751269TCONS_00001380-exon-sc0000010-1491911889:751169..751269Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:751169..751269TCONS_00001380-exon-sc0000010-1510915933:751169..751269Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:751169..751269TCONS_00001380-exon-sc0000010-1575043694:751169..751269Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:751412..751466TCONS_00001380-exon-sc0000010-1491911889:751412..751466Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:751412..751466TCONS_00001380-exon-sc0000010-1510915933:751412..751466Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:751412..751466TCONS_00001380-exon-sc0000010-1575043694:751412..751466Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:751753..751824TCONS_00001380-exon-sc0000010-1491911889:751753..751824Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:751753..751824TCONS_00001380-exon-sc0000010-1510915933:751753..751824Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:751753..751824TCONS_00001380-exon-sc0000010-1575043694:751753..751824Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:751993..752082TCONS_00001380-exon-sc0000010-1491911889:751993..752082Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:751993..752082TCONS_00001380-exon-sc0000010-1510915933:751993..752082Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:751993..752082TCONS_00001380-exon-sc0000010-1575043694:751993..752082Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:752233..752349TCONS_00001380-exon-sc0000010-1491911889:752233..752349Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:752233..752349TCONS_00001380-exon-sc0000010-1510915933:752233..752349Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:752233..752349TCONS_00001380-exon-sc0000010-1575043694:752233..752349Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:752714..752848TCONS_00001380-exon-sc0000010-1491911889:752714..752848Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:752714..752848TCONS_00001380-exon-sc0000010-1510915933:752714..752848Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:752714..752848TCONS_00001380-exon-sc0000010-1575043694:752714..752848Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:753136..753257TCONS_00001380-exon-sc0000010-1491911889:753136..753257Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:753136..753257TCONS_00001380-exon-sc0000010-1510915933:753136..753257Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:753136..753257TCONS_00001380-exon-sc0000010-1575043694:753136..753257Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:753660..753801TCONS_00001380-exon-sc0000010-1491911889:753660..753801Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:753660..753801TCONS_00001380-exon-sc0000010-1510915933:753660..753801Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:753660..753801TCONS_00001380-exon-sc0000010-1575043694:753660..753801Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:754203..754293TCONS_00001380-exon-sc0000010-1491911889:754203..754293Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:754203..754293TCONS_00001380-exon-sc0000010-1510915933:754203..754293Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:754203..754293TCONS_00001380-exon-sc0000010-1575043694:754203..754293Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:754432..754527TCONS_00001380-exon-sc0000010-1491911889:754432..754527Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:754432..754527TCONS_00001380-exon-sc0000010-1510915933:754432..754527Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:754432..754527TCONS_00001380-exon-sc0000010-1575043694:754432..754527Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:754644..754681TCONS_00001380-exon-sc0000010-1491911889:754644..754681Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:754644..754681TCONS_00001380-exon-sc0000010-1510915933:754644..754681Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:754644..754681TCONS_00001380-exon-sc0000010-1575043694:754644..754681Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:754905..754930TCONS_00001380-exon-sc0000010-1491911889:754905..754930Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:754905..754930TCONS_00001380-exon-sc0000010-1510915933:754905..754930Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:754905..754930TCONS_00001380-exon-sc0000010-1575043694:754905..754930Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:755244..755364TCONS_00001380-exon-sc0000010-1491911889:755244..755364Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:755244..755364TCONS_00001380-exon-sc0000010-1510915933:755244..755364Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:755244..755364TCONS_00001380-exon-sc0000010-1575043694:755244..755364Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:763733..763849TCONS_00001380-exon-sc0000010-1491911889:763733..763849Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:763733..763849TCONS_00001380-exon-sc0000010-1510915933:763733..763849Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:763733..763849TCONS_00001380-exon-sc0000010-1575043694:763733..763849Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:764452..764532TCONS_00001380-exon-sc0000010-1491911889:764452..764532Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:764452..764532TCONS_00001380-exon-sc0000010-1510915933:764452..764532Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:764452..764532TCONS_00001380-exon-sc0000010-1575043694:764452..764532Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:764909..765019TCONS_00001380-exon-sc0000010-1491911889:764909..765019Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:764909..765019TCONS_00001380-exon-sc0000010-1510915933:764909..765019Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:764909..765019TCONS_00001380-exon-sc0000010-1575043694:764909..765019Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:765577..765855TCONS_00001380-exon-sc0000010-1491911889:765577..765855Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:765577..765855TCONS_00001380-exon-sc0000010-1510915933:765577..765855Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:765577..765855TCONS_00001380-exon-sc0000010-1575043694:765577..765855Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:766346..766548TCONS_00001380-exon-sc0000010-1491911889:766346..766548Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:766346..766548TCONS_00001380-exon-sc0000010-1510915933:766346..766548Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:766346..766548TCONS_00001380-exon-sc0000010-1575043694:766346..766548Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:766840..766893TCONS_00001380-exon-sc0000010-1491911889:766840..766893Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:766840..766893TCONS_00001380-exon-sc0000010-1510915933:766840..766893Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:766840..766893TCONS_00001380-exon-sc0000010-1575043694:766840..766893Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:767182..767400TCONS_00001380-exon-sc0000010-1491911889:767182..767400Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:767182..767400TCONS_00001380-exon-sc0000010-1510915933:767182..767400Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:767182..767400TCONS_00001380-exon-sc0000010-1575043694:767182..767400Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:769429..770054TCONS_00001380-exon-sc0000010-1491911889:769429..770054Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:769429..770054TCONS_00001380-exon-sc0000010-1510915933:769429..770054Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:769429..770054TCONS_00001380-exon-sc0000010-1575043694:769429..770054Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:770465..770565TCONS_00001380-exon-sc0000010-1491911889:770465..770565Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:770465..770565TCONS_00001380-exon-sc0000010-1510915933:770465..770565Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:770465..770565TCONS_00001380-exon-sc0000010-1575043694:770465..770565Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:771288..771413TCONS_00001380-exon-sc0000010-1491911889:771288..771413Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:771288..771413TCONS_00001380-exon-sc0000010-1510915933:771288..771413Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:771288..771413TCONS_00001380-exon-sc0000010-1575043694:771288..771413Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:771771..771931TCONS_00001380-exon-sc0000010-1491911889:771771..771931Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:771771..771931TCONS_00001380-exon-sc0000010-1510915933:771771..771931Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:771771..771931TCONS_00001380-exon-sc0000010-1575043694:771771..771931Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:772396..772417TCONS_00001380-exon-sc0000010-1491911889:772396..772417Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:772396..772417TCONS_00001380-exon-sc0000010-1510915933:772396..772417Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:772396..772417TCONS_00001380-exon-sc0000010-1575043694:772396..772417Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:772821..772874TCONS_00001380-exon-sc0000010-1491911889:772821..772874Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:772821..772874TCONS_00001380-exon-sc0000010-1510915933:772821..772874Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:772821..772874TCONS_00001380-exon-sc0000010-1575043694:772821..772874Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:773049..773148TCONS_00001380-exon-sc0000010-1491911889:773049..773148Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:773049..773148TCONS_00001380-exon-sc0000010-1510915933:773049..773148Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:773049..773148TCONS_00001380-exon-sc0000010-1575043694:773049..773148Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:773301..773389TCONS_00001380-exon-sc0000010-1491911889:773301..773389Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:773301..773389TCONS_00001380-exon-sc0000010-1510915933:773301..773389Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:773301..773389TCONS_00001380-exon-sc0000010-1575043694:773301..773389Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:774126..774216TCONS_00001380-exon-sc0000010-1491911889:774126..774216Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:774126..774216TCONS_00001380-exon-sc0000010-1510915933:774126..774216Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:774126..774216TCONS_00001380-exon-sc0000010-1575043694:774126..774216Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:774690..774770TCONS_00001380-exon-sc0000010-1491911889:774690..774770Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:774690..774770TCONS_00001380-exon-sc0000010-1510915933:774690..774770Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:774690..774770TCONS_00001380-exon-sc0000010-1575043694:774690..774770Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:776551..776679TCONS_00001380-exon-sc0000010-1491911889:776551..776679Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:776551..776679TCONS_00001380-exon-sc0000010-1510915933:776551..776679Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:776551..776679TCONS_00001380-exon-sc0000010-1575043694:776551..776679Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:777438..777543TCONS_00001380-exon-sc0000010-1491911889:777438..777543Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:777438..777543TCONS_00001380-exon-sc0000010-1510915933:777438..777543Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:777438..777543TCONS_00001380-exon-sc0000010-1575043694:777438..777543Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:777929..778060TCONS_00001380-exon-sc0000010-1491911889:777929..778060Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:777929..778060TCONS_00001380-exon-sc0000010-1510915933:777929..778060Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:777929..778060TCONS_00001380-exon-sc0000010-1575043694:777929..778060Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:778758..778872TCONS_00001380-exon-sc0000010-1491911889:778758..778872Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:778758..778872TCONS_00001380-exon-sc0000010-1510915933:778758..778872Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:778758..778872TCONS_00001380-exon-sc0000010-1575043694:778758..778872Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:779347..779444TCONS_00001380-exon-sc0000010-1491911889:779347..779444Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:779347..779444TCONS_00001380-exon-sc0000010-1510915933:779347..779444Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:779347..779444TCONS_00001380-exon-sc0000010-1575043694:779347..779444Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:779982..780109TCONS_00001380-exon-sc0000010-1491911889:779982..780109Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:779982..780109TCONS_00001380-exon-sc0000010-1510915933:779982..780109Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:779982..780109TCONS_00001380-exon-sc0000010-1575043694:779982..780109Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1491911889:781139..782620TCONS_00001380-exon-sc0000010-1491911889:781139..782620Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1510915933:781139..782620TCONS_00001380-exon-sc0000010-1510915933:781139..782620Clytia hemisphaericaexon
TCONS_00001380-exon-sc0000010-1575043694:781139..782620TCONS_00001380-exon-sc0000010-1575043694:781139..782620Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:749360..782620 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.392839 0.790363 1.45165 1.1873 7.86991 5.43911 4.69377 6.08163 0.862053 4.79737 1.33071 2.85529 3.44937 1.551 1.79953 1.87545 4.77688 6.87139 2.46835 4.04563 4.76073 4.81669 2.23249 2.80875 8.15891 9.11038 2.71868 2.0718 9.17082 17.109
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001609Myosin_head_motor_dom
IPR002219PE/DAG-bd
IPR000048IQ_motif_EF-hand-BS
IPR000198RhoGAP_dom
IPR029071Ubiquitin-rel_dom
IPR027417P-loop_NTPase
IPR008936Rho_GTPase_activation_prot
Vocabulary: Cellular Component
TermDefinition
GO:0016459myosin complex
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0003774motor activity
GO:0005515protein binding
Vocabulary: Biological Process
TermDefinition
GO:0035556intracellular signal transduction
GO:0007165signal transduction
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0035556 intracellular signal transduction
biological_process GO:0007165 signal transduction
cellular_component GO:0016459 myosin complex
molecular_function GO:0005524 ATP binding
molecular_function GO:0003774 motor activity
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00001380 vs. Swiss-Prot (Human)
Match: MYO9B (Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3)

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 411/937 (43.86%), Postives = 605/937 (64.57%), Query Frame = 3
Query:  618 LYREKTDIDDLVALPVLNETVLLDQLCTRFCKGRIYTYVGGILIAINPFKYFPIYNPKYVNAYQNKKLGELPPHVFAIADAAYNRMLISKQNQCIVIXXXXXXXXXXXXXLILHHLTALSHKTKATVLEKTILAAGPVLEAFGNAKTSYNNNSSRFGKFTQINYRADGVVCGAVLKKYLLEKSRIVQQGINERNYHVFYSMLAGASQTERETLHLLTPQEYFYLNQTQCYTIEGMDEVYEFARLKNSIKNIGIPSITQQRMFAVLSAVLHIGNITFRKRSFP-EDSVSVADEKIIEIIAELIQVDKQELIVPMTMRKTITRGEEFVRQYKKDEAIATRDSMAKCLYASLFDWIVLQTNHIMVSKQGRKVDKKAFSIGVLDIFGFEDFERNSFEQFCINLANENLQFYLNQHIFKIRQDEYVEEGLDWDHVDYADNSTCLNLMVGKPTGLILLLDEECSLTIGTDESLLDKFNQHHSNNTCYEMPPTREPVFSILHYAGKVKYQIEGFRAKNRELMRNDVVSVFRNSRMLFVRELMGSDPVAIYYWSILRHTIKAVSIFXXXXXXXXXXQRMFEPKASVSWMKSKTPPNK--------SKALMRQLTEAEIDTTG---------QAMMRRATKVMNRRVLDM-AKRIQS----PSRMRSGLEARRTISGGMSEYARRGGL-----KQPPTVVAQFQSSLMELMDALNQSHPFFVRCIRSNAVKAPLKFEAELVLRQLRYTGMLETVKIRQAGYPVRIFVKQFVNQFRILLRAKDLDRISEDELTQMLTDLGLDTDEFQVGANKVFMRESQYQLLRDKMQQAVDRAATTIQVWY----HRRYLRKLKELEISSAIIIQKYWRGFVCRREYVYYQETRLRNRSARRIQNFWRTHEQTAARKPNKFNRFKRNVIKLQSIWRGYKCRNDYPKLLAERKEAEE 3332
            L R++ D DDL  LP L E  LL  L  RF + +IYTY G IL+AINPFK+ PIYNPKYV  Y+N++LG+L PHVFA+AD AY  ML  + NQCIVISGESGSGKT+ST  ++H LTALS K  A+ +E+TIL AGPVLEAFGNAKT++NNNSSRFGKF Q++Y   G+V GAV++KYLLEKSR+V Q  +ERNYHVFY +L G S+ ER+   L  P++YFYLNQ      +G D  ++F RLK +++ +G    T++++FAVLSA+L++GN+T++KR+   E+ + V   ++++ +++L++V ++ L+  +T RKT+T  ++ +  Y   EAI  RDSMAK LY++LFDWIVL+ NH +++K+  +      SIGVLDIFGFEDFERNSFEQFCIN ANE LQ+Y NQHIFK+ Q+EY  EG+ W ++ Y DN  C++L+  KPTGL  LLDEE +    T ++LL KF Q H +N  +   P  EP F I H+AGKVKYQI+ FR KN + MR D+V++ R S   +VREL+G DPVA++ W++LR  I+A+++ ++AG  RA+     E  A +S   +++ P +        S+ L R L    I +           +++++  +++   R   + +K I+     P  +      +  IS  + +   +  L     K+PP++ AQFQ+SL +L++AL ++ PFF+RCIRSNA K  L F+ ELVL+QLRYTGMLETV+IR++GY  +   + F  QF++LL  KD     E  ++ +L  + +D   +Q+G  KVF++E++ Q L++ + + V R    +Q W+     RR+  ++K     +A+ IQ  WR +  RR          R ++A  +Q  WR + Q        +   K+++I+LQS+ RG+  R  + ++++E+++AEE
Sbjct:  141 LPRQQADFDDLCNLPELTEGNLLKNLKHRFLQQKIYTYAGSILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYTMLRKRVNQCIVISGESGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFIQVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPEDYFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQIFAVLSAILYLGNVTYKKRATGREEGLEVGPPEVLDTLSQLLKVKREILVEVLTKRKTVTVNDKLILPYSLSEAITARDSMAKSLYSALFDWIVLRINHALLNKKDVEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYANEQLQYYFNQHIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFPHATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIVALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERA---EKAAGMSSPGAQSHPEELPRGASTPSEKLYRDLHNQMIKSIKGLPWQGEDPRSLLQSLSRLQKPRAFILKSKGIKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLEALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTEQFQVLL-PKDAQPCRE-VISTLLEKMKIDKRNYQIGKTKVFLKETERQALQETLHREVVRKILLLQSWFRMVLERRHFLQMKR----AAVTIQACWRSYRVRRALE-------RTQAAVYLQASWRGYWQRKL-----YRHQKQSIIRLQSLCRGHLQRKSFSQMISEKQKAEE 1056          

HSP 2 Score: 234.572 bits (597), Expect = 1.853e-61
Identity = 159/497 (31.99%), Postives = 250/497 (50.30%), Query Frame = 3
Query: 4257 ELEALNGFLMKKVADMNKPDPEKKNDSGADVTFKHALHKYHGNL--LFTCANASVNRKEEILLKFNDLVHGFQETLEQIINQADSGVSKEFSVMGVNLFRGILEEFQKNKDKLVVKTRSNIKHVKKKRRKTAEFYEHKGHVYTFQNFNIRTYCEYCNSYIY--DKGLVCQACAFTCHKKCHSKYPKTCK---GRRPSLCGPSTLFGTPMSELTSPNNPIPETVIKLMIEIEKRGLYTLGIYRKPGPQAAINNLKSVLTSTEAEELILEDEKPHTLASILKLFFRQLPQPIIPFNYYDDFIRSTDLENKKEIHSTLYELIQHLPKENKLLLERLIVHLGRVTSLVEHNKMSPNALAIVWAPCLLRASEDADPLESLAQLPKQTKCVEILIEFQVKSRKDMLNDIQALYRAESTAGEKLDDIIQ----------SEETDGDPEKNK---------------------ENDEMKEILKAQIQNMSTERERITNNMAAISP 5633
            EL+ L+ FL+ K+ D+      +   +  +  F  A  K+  N+  +++  N  ++      + + DL+  +Q     + N A     K+ +++ +NLF+ +L+EF +   K   +     K  KKKR++     EH GHV+     +I   CE C SYI+  DK L+C  C  TCHKKC  K    C    GR+         FG  +  LTS    +P  + KL+  +E  GLYT G+YRK G       L+  L  T+   + LE+   H +  +LK + R+LP+P++ F  Y DF+R+ +L  K+E  + +Y +++HLP+ N   LERLI HL +V  L + N+MSP ALAI++APCLLR  +++DPL S+  + K T CVE+LI+ Q++  K  + +I  L  AES A  +L  + Q          S   +G   K+                      + D  KEIL  +IQ++  E+E IT  +  + P
Sbjct: 1510 ELKYLDEFLLNKINDL------RSQKTPIESLFIEATEKFRSNIKTMYSVPNGKIH------VGYKDLMENYQIV---VSNLATERGQKDTNLV-LNLFQSLLDEFTRGYTKNDFEPVKQSKAQKKKRKQERAVQEHNGHVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSHCSYTYGRKGEPGVEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAANRTRELRQAL-QTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEKQEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEELEVLLEEEAAGGDEDREKEILIERIQSIKEEKEDITYRLPELDP 1989          
The following BLAST results are available for this feature:
BLAST of TCONS_00001380 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MYO9B1.853e-6143.86Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B... [more]
back to top