Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001309-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001309-protein
Unique NameTCONS_00001309-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length516

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001309-protein ID=TCONS_00001309-protein|Name=TCONS_00001309-protein|organism=Clytia hemisphaerica|type=polypeptide|length=516bp
MEKPKEMFRFPESFDVSDDNLDKDGTTPSPLDNPSTTPSFFVRNDEEKEK
TESANEKDRKTEPPPVKRGRSLLSFISDELERDYLLEQNEKKLKERRKRV
YTFFKTPQHLEKFLFFGFLLCFDVFLFIFTFLPIRIIIGLLRGLRNIFKR
NGRKILNPVQKVDLLKGIILVVVSLFMQSIDTSVIYHVVRVQSVIKLYVV
YNMLDMADKLLASFGQDVLDALFWTATEPRDRRREHIGIIPHLLLSFAYV
SAHVLLNLSQAIVLNVAINSFSKALLTIMISNQFIEIKSSVFKRFEKNNL
FQMSCSDARERLHYSIILLVVALRNFAEYEWNIEYAYSSFFPFAALVIGS
EFLVDWFKHAFITKFNNIQPDIYLTYRKFLAKNILSSRDDLVFTGHTDQV
SRRMGFTALPLAILLIKVVGQCVSLNGINGLCFAFSGYLCLCALKLLVSI
TVFGKASEYIKDDVTPVLDANTVRSPNDPTESNDKIFKQSWSFEPLNSVQ
DIYGGFNSNTKIFTGR
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000713XLOC_000713Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001309TCONS_00001309Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR008010Tatp1
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 77..97
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..69
IPR008010Tapt1 familyPFAMPF05346DUF747coord: 157..458
e-value: 1.3E-98
score: 330.3

Blast
BLAST of TCONS_00001309-protein vs. Swiss-Prot (Human)
Match: TAPT1 (Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens GN=TAPT1 PE=1 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 2.319e-139
Identity = 203/399 (50.88%), Postives = 275/399 (68.92%), Query Frame = 0
Query:   71 SLLSFISDELERDYLLEQNEKKLKERRKRVYTFFKTPQHLEKFLFFGFLLCFDVFLFIFTFLPIRIIIGLLR-------GLRNIFKRNGRKILNPVQKVDLLKGIILVVVSLFMQSIDTSVIYHVVRVQSVIKLYVVYNMLDMADKLLASFGQDVLDALFWTATEPRDRRREHIGIIPHLLLSFAYVSAHVLLNLSQAIVLNVAINSFSKALLTIMISNQFIEIKSSVFKRFEKNNLFQMSCSDARERLHYSIILLVVALRNFAEYEWNIEYAYSSFFPFAALVIGSEFLVDWFKHAFITKFNNIQPDIYLTYRKFLAKNILSSRDDLVFTGHTDQVSRRMGFTALPLAILLIKVVGQCVSLNGINGLCFAFSGYLCLCALKLLVSITVFGKASEYIKD 462
            SLL F+S EL R Y LE NE K  ERR+RVYT  + P+ LEK + FG  LC D FL++FT LP+R+ + L R       GLR+      R++L P Q  D+LKG+ILV+    M  +D S++YH++R QSVIKLY++YNML++AD+L +SFGQD+LDAL+WTATEP++R+R HIG+IPH  ++  YV  H +L + QA  LNVA NS +K+LLTIM+SN F+EIK SVFK+FEKNNLFQMS SD +ER    ++LL+V LRN  ++ WN ++ +   FP   +VI SE  VD  KHAFITKFN+I  D+Y  YR  LA +++SSR    +T ++D V+RRMGF  LPLA+LLI+VV   + + GI         Y  L +LK+L SI + GK+ +Y+K+
Sbjct:   69 SLLRFLSAELTRGYFLEHNEAKYTERRERVYTCLRIPRELEKLMVFGIFLCLDAFLYVFTLLPLRVFLALFRLLTLPCYGLRD------RRLLQPAQVCDILKGVILVICYFMMHYVDYSMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTATEPKERKRAHIGVIPHFFMAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLW-VLFPDVCMVIASEIAVDIVKHAFITKFNDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVARRMGFIPLPLAVLLIRVVTSSIKVQGILSYACVILFYFGLISLKVLNSIVLLGKSCQYVKE 460          
The following BLAST results are available for this feature:
BLAST of TCONS_00001309-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TAPT12.319e-13950.88Transmembrane anterior posterior transformation pr... [more]
back to top