Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001264-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001264-protein
Unique NameTCONS_00001264-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length770

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001264-protein ID=TCONS_00001264-protein|Name=TCONS_00001264-protein|organism=Clytia hemisphaerica|type=polypeptide|length=770bp
MEERRSEKYALICAILLTIVGGSWSLANNTINSQQNTTVTETVCWNITCN
SSEKCSTTITLNTTTSTLLQLDNQTCFRADCMDLKCAQQYLKQTVSLPMK
ESCVEMSCLNTSCIEDTISNTSCFPKQTSTSAPTTTXDISCFPKPTSTSA
PTTTTTTTKSMQQLRQEECDQYKYWLFKNKCSSRFSLCAKDVFLNMSQHI
ECLEEKGTQHYKYPAAPMLLIYHLIKYTKVFMKDEVLKMIKKTPFPIEVF
KKLVWYGEESFRMSDIVLPGYHKNPFKRSRRRWNGINDTLTVPYGNILRG
DFIYNFAMFDQVVVAKQEKEKYRLKDNWPDQHPISNGEYISFRSETGWKH
YTNHVINSIVVTFDIEPAMAELPTYNTIAFTHKDRKMVNPICVYWQPLNA
GKEGADPEAGYWTNYHMKILKTNKSMTVCKAYTFGSFAVLMEPYVPKNNS
QPLDVTEILFLAFISFSALLQLVYLAGMFSLKCHKNSANRLYIYANLSLF
MMQVLIVFSFRHRDDWEKCAIYTGWIQFFFINILSWLMMESVHRLSNLLH
FFHKDTNRDFLYHIVGLGIPLSNMIAMQGFPYDEYSSLRICWVYANDLRL
WYFINPITAIICASFLIKFITFKKYQGQDKFLENDFNYQQAQLSVFATGA
ILPTLLIGWTLMSVSVRTEAKLQNFLLIAASIAQVCLGLQVLYFYFYRNH
WVVEAMTEEKRIKEKKKLTTLSFLKGLPIRIRYKDNPYDAMEEKSEDSYE
MRYTSSSSLGDEIMLDESVY
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000671XLOC_000671Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001264TCONS_00001264Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000203GPS
IPR000832GPCR_2_secretin-like
IPR017981GPCR_2-like
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004888transmembrane signaling receptor activity
Vocabulary: Biological Process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007166 cell surface receptor signaling pathway
biological_process GO:0007186 G-protein coupled receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004930 G-protein coupled receptor activity
molecular_function GO:0004888 transmembrane signaling receptor activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000203GPS motifSMARTSM00303GPS_3coord: 388..446
e-value: 2.3E-4
score: 30.5
IPR000203GPS motifPROSITEPS50221GPScoord: 389..446
score: 11.247
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 465..673
e-value: 1.7E-12
score: 47.1
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 453..699
score: 15.626

Blast
BLAST of TCONS_00001264-protein vs. Swiss-Prot (Human)
Match: AGRL3 (Adhesion G protein-coupled receptor L3 OS=Homo sapiens GN=ADGRL3 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 3.051e-21
Identity = 76/285 (26.67%), Postives = 126/285 (44.21%), Query Frame = 0
Query:  352 TNH--VINSIVVTFDIEPAMAEL-----PTYNTIAFTHKDRKMVNPICVYWQPLNAGKEGADPEAGYWTNYHMKILKTNKSMTVCKAYTFGSFAVLMEPYVPKNNSQPLDVTEILFLAFISFSA-LLQLV-YLAGMFSLKCHKN-SANRLYIYANL--SLFMMQVLIVFSFRHRDDWEKCAIYTGWIQFFFINILSWLMMESVHRLSNLLHFFHKDTNRDFLYHIVGLGIPLSNMIAMQGFPYDEYSSLRICWVYANDLRLWYFINPITAIICASFLIKFITFKK 624
            TNH  ++NS V+T  I    +       P   T+    +  +  NP C +W              GYW+    ++L TNK+ T C      +FAVLM     K++    D    L L  I++   LL LV  L  +F+    +   ++R  I+ NL  SLF+ ++L +      D    CA++   + FFF+   +W+ +E V     L+  F  + +R   +++VG G+P   +       Y  Y + ++CW+  +   +W FI P T II  + +   I   K
Sbjct:  758 TNHSVIVNSPVITAAINKEFSNKVYLADPVVFTVKHIKQSEENFNPNCSFW------SYSKRTMTGYWSTQGCRLLTTNKTHTTCSCNHLTNFAVLMAHVEVKHS----DAVHDLLLDVITWVGILLSLVCLLICIFTFCFFRGLQSDRNTIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYK 1032          
The following BLAST results are available for this feature:
BLAST of TCONS_00001264-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
AGRL33.051e-2126.67Adhesion G protein-coupled receptor L3 OS=Homo sap... [more]
back to top