Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001055-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001055-protein
Unique NameTCONS_00001055-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length273

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001055-protein ID=TCONS_00001055-protein|Name=TCONS_00001055-protein|organism=Clytia hemisphaerica|type=polypeptide|length=273bp
MNRTFFNKIFDLLCSSFMARSKGGGFYAVKRGRNIGIYMTWAECESQVKG
FHGARYKKFGSEQEAQSFIDEVSSSNSSLGVRRTQTFKAKSQNTAFPGSV
TALSKRTKLIEARSLSTQASSSSTSSKPVVYTDGCCRGNGRSGAIGGIGV
YWGPDHPRNISEPLLVDEPTNQKAELEAAIRAIDCAIGMGLDDLELRTDS
TYTIKSMTEWIPRWERNGWKTSKGTDVLNKEQMIRLNDLCKRIDIKWTHV
RGHKGIHGNEEADRLANEGAMKT
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000598XLOC_000598Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001055TCONS_00001055Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR002156RNaseH_domain
IPR017067RNase_H1_euk
IPR011320RNase_H1_N
IPR012337RNaseH-like_dom
IPR009027Ribosomal_L9/RNase_H1_N
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0004523RNA-DNA hybrid ribonuclease activity
GO:0000287magnesium ion binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0000287 magnesium ion binding
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0004523 RNA-DNA hybrid ribonuclease activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002156Ribonuclease H domainPFAMPF00075RNase_Hcoord: 129..270
e-value: 1.8E-38
score: 131.9
IPR002156Ribonuclease H domainPROSITEPS50879RNASE_Hcoord: 124..271
score: 24.765
IPR017067Ribonuclease H1, eukaryotePIRSFPIRSF036852RNase_H1_eukcoord: 21..273
e-value: 2.0E-84
score: 281.6
IPR011320Ribonuclease H1, N-terminalPFAMPF01693Cauli_VIcoord: 26..68
e-value: 9.0E-20
score: 70.6
IPR011320Ribonuclease H1, N-terminalGENE3D3.40.970.10coord: 23..74
e-value: 6.8E-21
score: 73.9
IPR012337Ribonuclease H-like domainGENE3D3.30.420.10coord: 121..273
e-value: 1.4E-48
score: 164.0
IPR012337Ribonuclease H-like domainSUPERFAMILY53098Ribonuclease H-likecoord: 128..270
NoneNo IPR availableCDDcd09280RNase_HI_eukaryote_likecoord: 129..271
e-value: 4.03725E-76
score: 229.76
IPR009027Ribosomal protein L9/RNase H1, N-terminalSUPERFAMILY55658L9 N-domain-likecoord: 25..69

Blast
BLAST of TCONS_00001055-protein vs. Swiss-Prot (Human)
Match: RNH1 (Ribonuclease H1 OS=Homo sapiens GN=RNASEH1 PE=1 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 8.470e-65
Identity = 111/260 (42.69%), Postives = 151/260 (58.08%), Query Frame = 0
Query:   24 GGFYAVKRGRNIGIYMTWAECESQVKGFHGARYKKFGSEQEAQSFI-----DEVSSSNSSLGVRRTQTFKAKSQNTAFPG----SVTALSKRTKL-IEARSLSTQASSSSTSSKPVVYTDGCCRGNGRSGAIGGIGVYWGPDHPRNISEPLLVDEPTNQKAELEAAIRAIDCAIGMGLDDLELRTDSTYTIKSMTEWIPRWERNGWKTSKGTDVLNKEQMIRLNDLCKRIDIKWTHVRGHKGIHGNEEADRLANEGAMKT 273
            G FYAV+RGR  G+++TW EC +QV  F  AR+KKF +E EA +F+      EVS  + +   + ++   +K       G    S    +K  K  +E     ++ + S      VVYTDGCC  NGR     GIGVYWGP HP N+    L    TNQ+AE+ AA +AI+ A    ++ L L TDS +TI  +T W+  W++NGWKTS G +V+NKE  + L  L + +DI+W HV GH G  GNEEADRLA EGA ++
Sbjct:   26 GMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSASPEVSEGHENQHGQESEAKASKRLREPLDGDGHESAEPYAKHMKPSVEPAPPVSRDTFSYMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVG-IRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQS 284          
The following BLAST results are available for this feature:
BLAST of TCONS_00001055-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RNH18.470e-6542.69Ribonuclease H1 OS=Homo sapiens GN=RNASEH1 PE=1 SV... [more]
back to top