Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000513-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00000513-protein
Unique NameTCONS_00000513-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length443

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000513-protein ID=TCONS_00000513-protein|Name=TCONS_00000513-protein|organism=Clytia hemisphaerica|type=polypeptide|length=443bp
MQPMIKMEWLFWLMATAALVNFGYGLKSSADIYAKLVDVIKDKSADAEND
FLDKHYFTENKNDSIWKYSMDEAEKLLNQKYDLDELVTWEKEVRDLRMLF
KYCSNGKQSRPDCPSIFDRVHRYMKDWQWPALRGEFFRRFKAPIRTAFQS
MVMLMFSSMTKRPWVKTYKEANDWYDNISHEYSEVGKFYADFSKKIHEER
SWDFSAPEVCQYRRFMWKDFEQPACETRWRETDPPGGPKNKRSAVNHFIE
SEREVNIPIGLKQREKRSTDKQLLSKARKSDASHDLSEMPKKREKDDDDD
DDDDDDDDKSSDSSNSSEEEEKDPFFKAFAGNSQDQEIKIGGFASDFEFI
MKGRFKDETAGKEIIVDQRYINVRETTKGEVIEEMISEAYAKRTELVKSK
VAEMDKYVQDTYGTMRKAELLFLKNVKKQIKKWQSKNNIYIPQ
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000317XLOC_000317Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000513TCONS_00000513Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR015943WD40/YVTN_repeat-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 67..439
e-value: 6.3E-4
score: 17.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 228..330

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000513-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top