Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00000458-protein ID=TCONS_00000458-protein|Name=Dll1 distalless homeodomain protein|organism=Clytia hemisphaerica|type=polypeptide|length=352bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of Dll1 distalless homeodomain protein vs. Swiss-Prot (Human)
Match: DLX1 (Homeobox protein DLX-1 OS=Homo sapiens GN=DLX1 PE=1 SV=3) HSP 1 Score: 112.079 bits (279), Expect = 6.938e-29 Identity = 51/74 (68.92%), Postives = 63/74 (85.14%), Query Frame = 0 Query: 191 NGKGGKLPRKPRTIFTSQQLRELNRAFERTHYLSLPERAELAHALGLTQTQIKIWFQNKRSKFKKIIKANGGQM 264 NGKG K+ RKPRTI++S QL+ LNR F++T YL+LPERAELA +LGLTQTQ+KIWFQNKRSKFKK++K G + Sbjct: 122 NGKGKKI-RKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAAL 194 The following BLAST results are available for this feature:
BLAST of Dll1 distalless homeodomain protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|