Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000389-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00000389-protein
Unique NameTCONS_00000389-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length468

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000389-protein ID=TCONS_00000389-protein|Name=TCONS_00000389-protein|organism=Clytia hemisphaerica|type=polypeptide|length=468bp
LCKDEHQIHKCPKYVSLDQPERFEMAKKLNLCYNCLKKDHFTSKCKSKNN
CFNADCDERHHTTLHEYFIEHVKESFSGNTQVVEPSGTVYLSVVPVKLQG
LDSSSITTYALLDTGSQSTLVRDDVAKKLKLKKKDKKITITTINDIGAKT
KVKETSMRVENRDDGIGVNIDNCYIVPKSSFHMPKQQYPSTMMKKMKEEK
GIKLHNALYEEIGILIGANVPSVHIPLEVKEGENSEPLAIKTIFGWTLFG
ASGQPETVSMNRIVIKPEADLHHCVQRIWDQDFITNPSDRDEALSIEDKR
CHEKLESETVLADGKYQVPMLWKKDATFPNNRTVAEKRFHQLQNKLRREP
NLRKLYDQSMTKYLEIGYARKMTSEEATTEHPRTWYLPHYGVFNPNKPGK
IRLVLDAAAKFQGTSLNDALYTGPDLINNMLGVLMRFRTHHFAFSADIEG
MFNQVKVIQEDTQSLRFL
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000263XLOC_000263Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000389TCONS_00000389Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR021109Peptidase_aspartic_dom
IPR001969Aspartic_peptidase_AS
Vocabulary: Molecular Function
TermDefinition
GO:0004190aspartic-type endopeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0004190 aspartic-type endopeptidase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3D3.10.10.10coord: 333..468
e-value: 8.7E-6
score: 25.3
NoneNo IPR availablePFAMPF13650Asp_protease_2coord: 94..158
e-value: 5.1E-6
score: 27.0
NoneNo IPR availableSUPERFAMILY56672DNA/RNA polymerasescoord: 343..467
IPR021109Aspartic peptidase domainGENE3D2.40.70.10coord: 88..220
e-value: 2.1E-8
score: 33.9
IPR001969Aspartic peptidase, active sitePROSITEPS00141ASP_PROTEASEcoord: 110..121

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000389-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top