|
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00000303-protein ID=TCONS_00000303-protein|Name=TCONS_00000303-protein|organism=Clytia hemisphaerica|type=polypeptide|length=113bp ISIHKSTKRLKSQKTNSRQPSQSQRKLNTRNTRIIKMLFAVVLTFALCFL PVYVVQFFAFFHPYFIRCQYYMPRVAYFMGYLFQYANSAINPFLYFGFSQ SYRKAFKKTFLKR Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
This polypeptide derives from the following transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
Term | Definition |
GO:0007186 | G-protein coupled receptor signaling pathway |
Vocabulary: Molecular Function
Term | Definition |
GO:0004930 | G-protein coupled receptor activity |
Vocabulary: Cellular Component
Term | Definition |
GO:0016021 | integral component of membrane |
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category |
Term Accession |
Term Name |
biological_process |
GO:0007186 |
G-protein coupled receptor signaling pathway |
cellular_component |
GO:0016021 |
integral component of membrane |
molecular_function |
GO:0004930 |
G-protein coupled receptor activity |
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR000276 | G protein-coupled receptor, rhodopsin-like | PRINTS | PR00237 | GPCRRHODOPSN | coord: 34..58 score: 27.26 coord: 77..103 score: 26.26 |
IPR000276 | G protein-coupled receptor, rhodopsin-like | PFAM | PF00001 | 7tm_1 | coord: 8..95 e-value: 1.4E-13 score: 50.6 |
None | No IPR available | GENE3D | 1.20.1070.10 | | coord: 1..111 e-value: 2.0E-21 score: 75.7 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 1..27 |
None | No IPR available | SUPERFAMILY | 81321 | Family A G protein-coupled receptor-like | coord: 18..112 |
IPR017452 | GPCR, rhodopsin-like, 7TM | PROSITE | PS50262 | G_PROTEIN_RECEP_F1_2 | coord: 1..95 score: 14.394 |
Blast
The following BLAST results are available for this feature:
|