TCONS_00000120-protein (polypeptide) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000120-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length506

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000120-protein ID=TCONS_00000120-protein|Name=|organism=Clytia hemisphaerica|type=polypeptide|length=506bp
YIRIIVKRSKGLGSSLLQNLIMVDHGGGLVEDLEKKTGLTADQIVPLITL
FFAFWVGHIFRIWLSPQRISSQKRHFISMALGIIMLSIVFGEQAFHLLYS
CLISYTLMRFVDTSVVHVWVMGSAMLYLSLIHFKRMMLQDDNYVVDISGP
LMLATIKITYVGCGIHDKYHPRTTSDDARIILKKFPSPLEYLGYIFNFSS
VFTGPPPEYQDYMDFIDGKQYDKYKDELKGKQPSPMLVSIQKFILGYMAI
GMYGFVSSIFKPDFYKTPELYESSFWFKVMFAEIMVYHHKFKYYGAFGLG
ESICNASGLGFSGVDEDRNPTWDKLKTLRPLQIEYATNIRGYVDCWNLTV
NVWLKKCVYSRLKVIPFLGTWVFSALWHGFYSGYYTFFIPLGFALFLTRK
VRRTIRPYFLSSPSLKLFYDVITWFVTRLLLNFYAVGFATLNYAITFKFW
NSASHYGTAILLLGTLLVIVFQTQQQKKDHNQNDQSPSISTNGHPHVTNG
NHNGSR
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000066XLOC_000066Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000120TCONS_00000120Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR004299MBOAT_fam
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004299Membrane bound O-acyl transferase, MBOATPFAMPF03062MBOATcoord: 182..430
e-value: 1.4E-26
score: 93.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 480..506

Blast
BLAST of TCONS_00000120-protein vs. Swiss-Prot (Human)
Match: MBOA2 (Lysophospholipid acyltransferase 2 OS=Homo sapiens GN=MBOAT2 PE=2 SV=2)

HSP 1 Score: 244.202 bits (622), Expect = 1.880e-74
Identity = 148/471 (31.42%), Postives = 237/471 (50.32%), Query Frame = 0
Query:   31 EDLEKKTGLTADQIVPLITLFFAFWVGHIFRIWLSPQRISSQKRHFISMALGIIMLSIVFGEQAFHLLYSCLISYTLMRFVDTSVVHVWVMGSAMLYLSLIHFKRMMLQD-DNYVVDISGPLMLATIKITYVGCGIHD---KYHPRTTSDDARIILKKFPSPLEYLGYIFNFSSVFTGPPPEYQDYMDFIDGKQYDKYKDELKGKQ--------PSPMLVSIQKFILGYMAIGMYGFVSSIFKPDFYKTPELYESSFW-FKVMFAEIMVYHHKFKYYGAFGLGESICNASGLGFSGVDEDRNPTWDKLKTLRPLQIEYATNIRGYVDCWNLTVNVWLKKCVYSRLKVIPFLGTWVFSALWHGFYSGYYTFFIPLGFALFLTRKVRRTIRPYFLSSPSLKLFYDVITWFVTRLLLNFYAVGFATLNYAITFKFWNSASHYGTAILLLGTLLVIVFQTQQQKKDHNQNDQSPS 488
            + L     L  DQ+  ++   FA      FR +L   + SS  RH ++  LG+ +    FG  A H L    ISY +M  +    +H +    A+ YL++    R+ + D   Y  D SGP+M+ T KIT + C IHD   +     TS    + +++ PS LEYL Y  NF  +  GP   Y+DY+ FI+G+ Y   +    GK+        PSP    +QK ++  +++  +  + +    ++        ++ W  K+++  I +   + KYY A+ L ++I NA+G GF G DE+    WD +  LR  QIE +T+ + ++D WN+   +WLK+  Y R    P + T++ SA+WHG Y GYY  F+         R +R   R YF+    LKLFYDVITW VT++ +++  V F  L+   +  F++S  +    + +L  LL+ V +TQ++K  H     S S
Sbjct:   13 QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTSFSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYFIEPSQLKLFYDVITWIVTQVAISYTVVPFVLLSIKPSLTFYSSWYYCLHILGILVLLLLPVKKTQRRKNTHENIQLSQS 483          
The following BLAST results are available for this feature:
BLAST of TCONS_00000120-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MBOA21.880e-7431.42Lysophospholipid acyltransferase 2 OS=Homo sapiens... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php