TCONS_00000115-protein (polypeptide) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000115-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length110

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000115-protein ID=TCONS_00000115-protein|Name=|organism=Clytia hemisphaerica|type=polypeptide|length=110bp
MAETSTSELACVYSALILHDDDVDITADKIQKICTAANVTVEPFWPGLFA
KALEGRNIGDLISNVGSAPAAGAAAPAAGGDAPAAGEEKKEEKKEESEES
DDDMGFGLFD
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000062XLOC_000062Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000115TCONS_00000115Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR027534Ribosomal_L12
Vocabulary: Molecular Function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: Cellular Component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
Vocabulary: Biological Process
TermDefinition
GO:0006414translational elongation
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006414 translational elongation
cellular_component GO:0005622 intracellular
cellular_component GO:0005840 ribosome
molecular_function GO:0003735 structural constituent of ribosome
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF00428Ribosomal_60scoord: 25..109
e-value: 4.9E-29
score: 100.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 70..110
NoneNo IPR availableCDDcd05831Ribosomal_P1coord: 8..109
e-value: 7.52344E-34
score: 113.571
IPR027534Ribosomal protein L12 familyHAMAPMF_01478Ribosomal_L12_archcoord: 9..110
score: 15.588

Blast
BLAST of TCONS_00000115-protein vs. Swiss-Prot (Human)
Match: RLA1 (60S acidic ribosomal protein P1 OS=Homo sapiens GN=RPLP1 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 4.016e-27
Identity = 72/112 (64.29%), Postives = 78/112 (69.64%), Query Frame = 0
Query:    5 STSELACVYSALILHDDDVDITADKIQKICTAANVTVEPFWPGLFAKALEGRNIGDLISNV------GSAPAAGAAAPAAGGDAPAAGEEKKEEKKEESEESDDDMGFGLFD 110
            S SELAC+YSALILHDD+V +T DKI  +  AA V VEPFWPGLFAKAL   NIG LI NV       +A AA A  PA    A  A E+K E KKEESEESDDDMGFGLFD
Sbjct:    3 SVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD 114          
The following BLAST results are available for this feature:
BLAST of TCONS_00000115-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RLA14.016e-2764.2960S acidic ribosomal protein P1 OS=Homo sapiens GN... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php