TCONS_00000113-protein (polypeptide) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000113-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length242

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000113-protein ID=TCONS_00000113-protein|Name=|organism=Clytia hemisphaerica|type=polypeptide|length=242bp
PKSVLLDKVVYLKRSSNSIHKMKVLILIFLGILTLVQNQMMDFKFLNPLK
DKKLVDESLFLYQTDNVPQQKCVIDCAASPKCGSVNHHDKTQTCILNREP
NSNGEDVKDFLTNAEGWIFFQKTKTKDSPKIPEGDVINKNEEFYTERGKI
IQEMDVLPLQWKLSFKFKPRVMGYEKISSLIHFQSKKISGGSKANIIAAG
VSKNQHLYVKLITATNFTAFYTYSKEPLQPEQWIYVRIKNYL
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000061XLOC_000061Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000113TCONS_00000113Clytia hemisphaericatranscript
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3D3.50.4.10coord: 37..127
e-value: 1.3E-5
score: 24.6
NoneNo IPR availableSUPERFAMILY57414Hairpin loop containing domain-likecoord: 63..123

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000113-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php