TCONS_00000106-protein (polypeptide) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000106-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length273

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000106-protein ID=TCONS_00000106-protein|Name=|organism=Clytia hemisphaerica|type=polypeptide|length=273bp
MWWRATSLMTEDLKKSSKARLPKGFYHGENQIQGFQSGCGNTLSRNLNDD
ELCQTNRTLISYKNVTLPDKLYGGRNKQPCIVTDDKEFLQRKIMKELNVG
SLDFSIAMKTYQNVVKVQNEENAYVGEEESIGAPLKDSDVDTKVKGCEDA
SPTNDNALLEELRTIKGDYGKIKGDYESILERNTAAETEIRRLSLVKEES
DLAHREEADALCNTIENLNKQLIMAREEVEDMSFDIKECVTDTTSKLKQH
FDVLLTEEKKHNQGLLAEKEAKI
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000054XLOC_000054Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000106TCONS_00000106Clytia hemisphaericatranscript
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 208..235
NoneNo IPR availableGENE3D1.20.120.330coord: 193..272
e-value: 0.086
score: 12.0

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000106-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php