Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97350_cuf3 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97350_cuf3
Unique Nametranscript:BL97350_cuf3
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97350_cuf3

>transcript:BL97350_cuf3-protein ID=transcript:BL97350_cuf3-protein|Name=transcript:BL97350_cuf3|organism=Branchiostoma lanceolatum|type=polypeptide|length=867bp
DGTWTGIQPVCYSLKCQTLTIPAHGTVHMVGGSLFGGTATYSCDAGYEVV
GTPVRMCQASRTWSGNEPTCEKISCVSLAAPLNGGISGFNQYGDTVTYDC
STGFQLVGDQTRTCQSDQQWSGTQPHCQRLQCPQLGTIANGGYTGGLYYG
DHASFTCNTGYDIQGNTSAVCMDNGQWSSTAPSCIAQECPPLTAPADGAM
SGTFFVGDRVTFSCKTGFDLVGSNVIVCQATQTWSGTEPKCQSVTCSSLL
APVYGSVRAPGNTYGDTATISCEPGYELIGDSVRTCEASGLWSGSTPLCQ
RKCCSALSVPFGDYVGTICYNDTITFNCDPGYEMFGATGATCNETGHWDT
AVPQCQKVCCNSSPVIPNGQLTTARGNCFNDVGLVDCSVGYVNYGNDILY
CNASGQWEGKMPQCQLMCCGDPGSIRDGAVSYTGLCYGDVATYSCDNGFT
LVGNATYTCSASGDWGPSPYCQPYSLCDRNTLSAPHGGTKICFDSPQGTD
LIEYCQMHCNAGKDYSNHNEALYECSAATSWKWMVRRFVPGGFSSFIDVN
VGICSAAAYFNPFAAVVANGLTITFSGAVDMAAVEAEMKNYLLTNNLCTL
PCQVSNIELQIDPTARVGPRAKAARSNSRATMSVQLYAYADESRITATNT
VQMEWVRLAGELSEVMTTLQQPGGITLTVQGVEVVLHAENMQISPPSLGC
QLGEVQEGVRCRKCGQGTYYDIYENDCRPCPYATYQDESGQTECKPCKEG
TTTAMMSARNSTQCQAFAECNCGIHPCKLTDSAGYVCDCLDGYEQADIAG
ELLCKDIDECMQPDVCPNAACHNRPGTYSCECLPGFEEPNCIDIDECRYV
GFCPDNSECTNTPGSYN
Run BLAST on NCBI

mRNA from alignment at Sc0000091:603008..612979-

Legend: five_prime_UTRexonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97350_cuf3 ID=transcript:BL97350_cuf3|Name=transcript:BL97350_cuf3|organism=Branchiostoma lanceolatum|type=mRNA|length=9972bp|location=Sequence derived from alignment at Sc0000091:603008..612979- (Branchiostoma lanceolatum)
CTGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTGTAAGTTACTG AACTATATCTGTCTAATACTAGTATTTGGCTCAGGACTTAGCATCTCAGT TCAACGTATTAATACTAGTACGTTAGATTATACTAGGCGAATAGACTTAA TGTCTATTTTGTTCTGATATCGCAGAACTTCAAACAGCTGATGAATGTTC AACTTTGGACTGTTACGATTCAGCTTGCGTGTTATCTTTATCATAATCGA AATCAAAGTAAAAATTAAATGTCTTTCTACCATTTATGATGGAGGTATAA TGGGCGGCCTTATACTGATGCCACACGCATGTTTTTGATACATGTCATCA CTGAGAAGTACAATTATTTTAGCACAGACGAATGAATTACTGAACCATGA TAAATCTTTTTAATGTTAATTTTGTTCTGTAACTGACTTGCTCCTAGCCT TGAAGTGTCAGACTCTGACTATACCTGCCCACGGAACTGTACACATGGTC GGAGGGTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGTA CGAGGTGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGGA GTGGAAATGAACCAACTTGTGAAAGTAAGGAATTAGTTCATGAATTACTG TAATTAAAGGACCATTCTCAAAATTTCATGATTCACTCAAAAATCTGGAT ATCATGAAACATTGGCTAGACAGCTCAAAGGGTGTAAAATTGATGGTTAA AAATGTATCCATTGTCAGATGCACATTAGCTAATTATGATTCAGTGGTGC ATTCTTAGGACAAGACTATGATGATACACTTTCTTTTACAGAATACAGGG TACAACAGAATGCACTAGACCAGGCTGAATGTAGACTGTAATAGCTAGGT TACTAGATCATGCATCATTTTAAGGTAGAATAGAGAAATTCAGTGTTTAT CTTTAGAGAGTCTATAACACAAGATGTGTCAACTTATCATTACAGAAATA TCCTGTGTTAGCCTGGCCGCTCCCCTCAATGGTGGGATCAGCGGGTTCAA CCAGTACGGAGACACGGTGACATATGACTGCAGCACTGGGTTTCAGTTAG TGGGTGACCAGACAAGGACCTGTCAGAGTGACCAGCAGTGGAGTGGAACA CAGCCTCACTGTCAAAGTAAGTTGATTTCACTTGACACTAGACTATAGTC TCATTAGAGAGAGAGAATCCCCTCACATGTTCTTGGTGCTGATTGGTTGA CAGTAGCTCAGTGAAATGTTTCTCATAAGTTAATTTGCGTGTTTCAGTGC AGTTCAGTACCATCTCTGTCATTTGTGCTGATTGGATAGCAGTAACTCAA TTGCAAGGTTTCCAAGTCCCCATTGTATTTATTGGCTTCCTCCTCCATTA TAACCAGTGCTGTCCCTGTCCTTGGTGCTGACTGGCTGCTTGCAGCTCAC TGTTTGCTTTCAGAGATAGTAGTTCCACAATGTTTTCATTTCAGGATTTT CTAATCATAAGACTTAAGATTCTGAAATAACCATTGAAGTCATTATCTGT TTGCAGTAGATTGTATTAAGCACAATCATTTATGTTCTCATATTTTAATA CCAGTGATGGGAAGATTGTGTCATAATGTAATTTGTGTATGAAGTTAACA TGAAGAATACTGACTGAACTGCAGTGAAACAAGCACTACCTGTAGTGATA GTATTAAACATCAGTCTTGTTCTACCATTAGGACTGCAGTGTCCACAGCT TGGTACGATCGCAAACGGTGGCTACACAGGTGGGCTGTACTATGGTGACC ATGCCTCCTTCACGTGCAATACTGGGTATGACATTCAGGGGAATACCAGT GCAGTTTGCATGGACAACGGACAATGGAGCAGTACAGCACCTTCATGCAT AGGTAAAAAGCTAAAATGACGTAACTTGATCAATGTAGCCTAGCATTGTA AGTTTTACTTTCTAAGTTTTAAGATTGACGTGCTAAAACCTTCTGCATGA AAATAATTCAGGATATGAAAAATATGCTTCAATCCATACTGACCATGCAA CTTACTGACCATTGACTGTCATTTCATCACACTCACTATTATGTCTTTTG AACATTTTTTTCAATCCTTCAGCACAAGAATGTCCTCCCCTGACAGCCCC AGCTGATGGTGCCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACAT TCTCCTGCAAGACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGC CAGGCCACTCAAACATGGAGTGGAACTGAACCAAAATGTCAAAGTAAGAT TCGATGTTTTCAACATCATAGTATTACTAGAATTCAATAAGTTGCTTTTA GATAGTCTTCTTGGCATTCTGCCACAATTGAAAGAATGTAGAACATTAAA ACAGATAATAATAGTCTGACTCTTTTTATGCAACAAAGTGATTCATTCAA CCAATGTTTTGGTGACAATCTGTCACCTTCATCAAGGCAATTCTGACTGG TTCACATTGCACTGCAGCACAGATGTCGCTTCTTATGGATGCGTTCCCAA ACGCAAAGTATTTACATAAATACACTGTTACAGGGCCAGGGAAGGACATC GACAATGGGGTCCCAAACGTACAGACGTTTAACACATAAATAGTCTATTT TTAAGTATAATAAGTCAATTTTTAACCGTGACGTATTTTGGCTATGTCAA TCTAACAGTATTTTTTTCTTCTGTCTTTGAAATAAAGGTGTTACTTGCAG CTCTCTCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACTT ATGGTGACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGGT GACAGCGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGCC TCTTTGTCAAAGTGAGACAGTTACAACAATCAAGGAGAAAGCTATGTGGC ACTCCTACTGAAACACCTGCTGCTATGCAGTTATTTATAGGAATTTGAAT TTTTCTAAATCATATATTTTCATAGATTATTATTGATGAAAGAAAAATGA CTACTCCTTCAGGTTATTAGTCATACATTATTTGTGATTATGATGATAAT GATAGAATGAATTATATTCTGCTCAATAAAAATGAAAACATTTGACAATT TCACTTTCAGTTCACCCAATGCACTATACAAGACATGCAATTGTGCAGAA ATATGATACTTACCATCGGTTCAAGATGCATTGTCCGAATGTATATCAGG AACATGATTTCCTTGTCTCCTCAACAGAAATAATTTCTCTTCCCTTCCAA CAGGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGATTATGTGGGA ACTATCTGCTACAACGACACTATCACCTTCAACTGTGACCCCGGCTACGA GATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTCATTGGGACA CGGCAGTTCCCCAGTGTCAAAGTAAGTAAGCAGCAGTGTGTAAAGAAGTT GACATTGTGTATCATACTTACTACAGCATCTTGTCAATTGGTGTCATGGA AAATCGTAATTACAGAGAAATTGTAACACTATGATACTTCAAAAGTACAC AGCTACATTAATGTTACTACTGCAGTTGTCTCTTTCTAGACCTCAAAACA TGCCCACATACTCTACGTCGCCAATATGTTTTTTTAACACCAATCTTGTT TCAAACTTTTGCCCAGAGGTGTGCTGTAACAGTTCCCCAGTGATCCCCAA CGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAATGATGTGGGCCTGG TAGACTGCTCGGTAGGCTACGTAAACTATGGAAACGATATCCTTTACTGC AACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAATGTCAATGTAAGAA CACAACGTTTTTTATGTCATTAAGTGATATACGTACATGTATAGAAATCA TTGTATAGTCATGGCTTCTTTGAAATGAGACTGATTCAGAACTTGTCTAC TGTGTACTGTATGTTGTAGGTGCATCAAAATATAAGCCTGCATGATGGCA AAGAGACTTTCAAATTGTCAAAAATGATAAGTAGATTTTTTTTATATTTA CCAGGTTGTATTATTTCAGCCAGTAGGTACCCATATGAGTAATGAGGCTG TTGTAATGCACTCAAGTCACCTCCTTGAACACGGGAGCCCCATTTTTCGT CTCTTCCCAAAGACGGTGCAGCTCCGACAAGGATACCCTTCCTGGGATTC GATCCGGGGTCTCCCAGATCCAACTAATTAGAAACAGGAGGCTCAACTGC GAAGCCGCTACCAATTGAGCTACAGGGACATCCTATACTCGAAATCACAA CTGTTTTATTGATCTTCTAAGGTTTAAAGACAGGAACAGCCAGAATGGAC CATTTTGATTGTTTTAGGAACTAGATTGTGGGAAAGCTTGAACCCAAAAT TCTAAATTGTTCATCATGATTTCAATAGCTACTACTGTTTCTTTACTGCA GTATAACTGTTTGCTTGGTTCTCTCCACCTGACAGTAATGTGCTGTGGAG ACCCAGGGTCCATCCGGGATGGTGCAGTAAGCTATACGGGACTGTGCTAC GGTGATGTTGCAACCTACTCGTGTGACAACGGATTCACTCTTGTGGGCAA TGCAACATACACCTGTTCTGCAAGTGGCGACTGGGGACCATCACCTTACT GTCAACGTGAGGAAAATAACAATTATGCTATGTCTATAGCAACATATAGC TTACTCATATCAAACTATTGTATCTTATCATTAATCTCATTATTGTATTC AACATCAAATTGAAATATGGTCTTGTTTGACTGTTTGGTTGAACTACCAA AAAAATCATGTGAATATCAACATAAGTGGGGCAGGGTTGAAACAACTCAG TTGGAACTGTGTGGCCATTTTTTTCTCTCCTTGGGCTGGAGACTTCTCTG GAGTTTAATGTTTGGAATTCCTTATTCAGACTAATATCTGCATATGTCTT GTTCTTTCTTGAAGTTGGAAGTTCACCTAATATGTGAATTCTAGACAGAT TATTTTTCATTTGCGCTTTTAACAACTTTATTGGGATGATTTATGGTTTG GTGAATCGGTCATTAATTCAAGGTTATCAAATTCTGGAATAAATCTAACT TCTTATGGATTTTCTGTCTGTCTTAACAAAAAGCTATCTTAAACTATATA TGCTTAAGCCAATATTACTATATTAATTTATTAACTTAATGATTTATTGC ATCTCTTTCAAATACTACTGATGCAGTCTTGCTGCCTTATCCCTTTCAGC TTACAGCTTGTGTGACAGAAACACCCTGTCAGCTCCACACGGAGGCACCA AGATCTGTTTTGACAGCCCCCAGGGAACGGACCTCATAGAGTACTGCCAG ATGCACTGCAACGCCGGGAAGGACTACTCCAACCATAATGAGGCTCTGTA TGAATGTAGCGCTGCAACCAGCTGGAAGTGGATGGTTCGTCGCTTTGTGC CAGGCGGCTTCAGCAGTTTCATTGATGTCAATGTTGGGATTTGTTCTGCC GGTAAGTAATTAGGTAAATGTGGTGGAAATTTGTACTTAGGAACAAATAC TCAATTTTGACAAAAATGCCCCTGCAGTTCCAAGCAAGCTGCTAGGGGCC CAAACCTATCCTACTTCTTCCTTACATGACAAGCTATATGCCACCAAACA GCAAAGACCATAGCACGTCCAGGTAAAATGAGGCAGGACCCGTAAGTTCT GCTGCAGTACCAAAGTCACAGACCAGAGGTCCCAAAATAGACCTTTGTCT TCCCAACACCTTCCCATCTACCAAATGTCATCAGAATCCATCAAGAGGTT CTTGAGCTATGCTGACTGAAAAAATCTGGAAACACACAGACAGACAGACA CAAAAAACAATATCTCCATTTTTCATGGAGATAATTACTCATGACTTAAA GGATGCATCTGTTGGGTGTCCTGTATGAAGGGTTAGTAAACACGCAAAAT CCTTGATGTTTGTGTCACGCTAAAATCAGAGATTTCCCTAACACATTACA TTAGATTCGATCTCTAACTTATTATACTTCACATAGGATTAGAGTGGTCC CGTTATGAATAACAGATGAATATAACAACAGACTTTTCTAACACATTCTA GGAAATCCTTCATGCCCTTTCTTCTTGATATCCTCTACAGCCTATTTCAA CCCGTTTGCTGCCGTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAG CCGTTGACATGGCAGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACC AATAACCTCTGCACTTTGCCATGTCAGGTGGGTTTTTTTCTCCACTAGTG TCTGTATCATTACCTCCTTCCCATAAGGTGCTGTTCAAACATACTTAAGA ATTGCAAATTGAAGAGACACATCAAAATTCAAATTGCTGTTATCTATTGA TGCAGATTATGAATAGGTAATGTCAGCTGTTATGACTTTGCCAAGTATCA TATTAAAAAAGACCGCCACATAAAGAATAGCGGTGGTATCGGACACCTAG ACATCTGGAATGTGCATACATGTACCGCTGGGATTTCTGATGCTGCATTT GATTTAGTTATCACTTTGAATGAACTTTTCTTTAATGTGGGGGTTTTAGA GTTACCAGTGGAATCAAGAGAATCGATATTATATGATAGGATTTTAGATG TCATTTCTACCAAACAAACCGTGTTGATTTCAGGTTAGCAACATTGAGCT GCAAATTGATCCTACGGCCAGAGTGGGACCACGAGCAAAGGCTGCCAGAT CTAACAGCCGTGCCACCATGTCAGTCCAACTCTACGCCTACGCAGACGAG AGCCGCATTACCGCAACGAACACAGTTCAGATGGAGTGGGTTCGTCTGGC TGGAGAACTTAGGTACTGTACAGTTGTACTTGATGAATAGATCAACAATC TCTGTGGCAATTAGGAGTCCACTGGTTAGTCACAGTCCATACCTCTGGAG CTAGAGGCTGGGAGTTTGAATCCTGATCGTTGTTTCTCTACTGCAAAAGG TTGCAGTCCTAAAGCCCCATTTTCTTGATCATGTAAACTGGTTCAAGATC ACTTTTACCACTGTATGAGACTTTTGCTGCTCCTACTCTGATCAGAGACT GCTGGTGACTATGAATCCGAATACATTACCGTTTTATGTATTAGAGGGAT GGATCCTCATTACACTGCATCCCCTGCTAGTAATTAAATCATTTCAATCA TGATTCCATCTTTTGTCATTTTGTTTTAGTGAAGTGATGACAACCCTCCA ACAGCCAGGAGGGATCACTCTGACAGTCCAGGGAGTGGAAGTTGTGCTTC ATGCTGAAAATATGCAGATCTCCCCACCAAGTCTGGGATGCCAGCTGGGA GAAGTACAGGAGGGGGTTCGGTGTAGTATGTATCACTCAGGAAATAAGAT TATGAACAATAAACAAAAAACAATTAAGCAGTATGGCATTGGGTGACATT ATACTTCACTAGAGTCACTACAAGATTGGAAAAGTAAAGCCTCTTCAAAT TGACAGGGTTTTTCTTGAGATGATGTTGATTTGTTTGACGATGTCTACAG AGAAACGCTATGATACCAATAGCAAAATACACTACTCTCTTGGCTTTAAT ATGATACATCCAATCTTGTATTTTCCAGAGTAGCTTAAGTATACAACAGT TAACATTTAGGGATATCAGGGTTTTTTTCACAACCAAAAGTTAAGTACTT GCCAATGTCTTAATAGCCCTTCTGCTACCTCCCTAGGGGTAACGATGAGA GTGCAATAACTACTTCTTGCTGCTAGGTGGCACTGCAGCAAGAAGAATAT GGTTGATTTGTGAACAGTTCCATCAATGCGCATAATCAAGTTCTTCTTTG TTGTATTCTACTGTACAAGTAAACCCATAAGTTATGTTGATTGTACAATT TCTGTTTCACAGGAAAGTGTGGCCAAGGCACATACTATGACATATACGAG AACGACTGTCGCCCGTGTCCGTACGCCACTTACCAAGACGAGTCGGGACA GACCGAGTGCAAACCATGCAAGGAGGGAACCACAACTGCCATGATGAGTG CCCGTAACTCCACCCAGTGTCAAGGTATCTAACGTTATGTCCAGCTTCTG CTTTAGTTGAAATCTGTAACATTTGAAGAAAGTTTGGACTTATACTTGAT TATGCTCAAAAGATAGACTAGTGTTGACCAATAATGGTTGGTACCAAATT ACTTTATTCCGACTTTATCATCACATGCATCTACATTTGCAAGCAACATG TTTTGTGTATGCATTCCAGTTTAGCTCAGAATGCGTTAGATATAACTCTA GGCTTGAAATATTTTTGACTTGGACATTTTCTAGTGTTTTCGCTCTTATT AAAACAATGAAATGCTAATTGCAGATACTTTTAGCACCAAGGACAGGTCC AGGTATTTGCATTGCCTATCTGAAATTTGAAACTGATTTAAATCCGGGCC TTATTACTTGAATCAAAGTTGAAAGTATTGATATGAGAACCTTATAGTCA GCAATCTGTAATTGAAGATTTCAGCACCAAGGACAGGTCCAGGTTGTGCA ACTGGTTATCTAAAATTTGAAGTGGATTTAAATCTGGGCTTTATTACTTA TACATGTAAAATCAAAAATGAAACATTTGATGTATAACAGGAGTACCTAA TAGTCAATGAATTATCATCTAATATGCTTAGAGTCGAAAATATTGTATTT TTTGTCCTTGCTATTGAATGTGAAGCTAATGCATATCTGCAAGAACCTGA GATGTTCTGGCAAACATTTTGTTCACTTCACTTCTTTCCAGCTTTTGCTG AGTGCAACTGTGGCATCCATCCGTGCAAGCTGACCGACTCAGCAGGATAC GTGTGTGATTGTCTGGATGGGTACGAACAGGCAGACATCGCAGGGGAATT ACTGTGCAAAGGTATGTTATCCATCATTCCTTGTATTCCGTATTTCTAGC ATGCCAGTAGGAATACATTGCCAGAAAATCTGCATATTTTTTAGATGATG GTCCTTGTGAGATGTATTTGGGAACACCAGACCTATCTCTGCTTGCTACA AAGAAAGATCTATGCTATGCCTTAACCATTGTACATTGCCATGCTGCAAA CAAAACAGCTTGAAGTCTCCAAAAAGTGTTAATATGAGCAGTTTTACAGA CATGACATCTAAAAGTGTATAAAAATCTGCAGTAGTTTTTTCCATGGAAA GACATGGTAGAAATGTATGCTTAACAGGCTTCCATTTATTTCATTATCAT AACTTAGTATTCTAAATTTTAACTTGCACTAGCCATTAAAAATAACATGT AGTAACTTTTTATGGCATGATAATTCATAATCCAGTTTCTGAATCACAAG GTTTGGCTTTGACTGTTGATTCTGTGTTTTTCCTTCGGTGTGTATAGACA TCGATGAGTGTATGCAGCCAGACGTTTGTCCAAACGCTGCATGCCACAAC CGCCCGGGGACCTACTCCTGTGAATGCTTACCAGGATTTGAGGAACCAAA CTGTATCGGTAGGCATTCTGTTTATCTACCAGTACACCACACAACATCTT AAGTAAGATGTGGAGCAGGATCTGGTTTGGAATCATTTAAAGTACGAGAA AATTTTAGATTTAGAAATATACTAGAGTTGAATGGAAGGGTAAGGTCTCG AGAGGATTTTAACTGTTACGTTTGTAACATTTTGCAATTTTCATAATCAT ATTCCTAGAATATAAACTTAACATTGAATTTATAGAGAGCAATCCAAATA TTCTTTGGGATTTTTACAGGTCTTTCCATTGAATTGGCTTTTACTGGTCA TTTCTGTGAATGTATCTTCATCAGATTTGTAATGTTTTTGTCCCACAGAT ATCGATGAGTGTCGGTATGTGGGTTTCTGCCCAGATAACTCCGAATGTAC CAACACACCCGGCAGTTACAAC

Coding sequence (CDS) from alignment at Sc0000091:603008..612979-

>transcript:BL97350_cuf3 ID=transcript:BL97350_cuf3|Name=transcript:BL97350_cuf3|organism=Branchiostoma lanceolatum|type=CDS|length=44217bp|location=Sequence derived from alignment at Sc0000091:603008..612979- (Branchiostoma lanceolatum)
GATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTCCTTGAAGTGTCA
GACTCTGACTATACCTGCCCACGGAACTGTACACATGGTCGGAGGGTCGT
TGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGTACGAGGTGGTC
GGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGGAGTGGAAATGA
ACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCGCTCCCCTCAATG
GTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTGACATATGACTGC
AGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGACCTGTCAGAGTGA
CCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGACTGCAGTGTCCAC
AGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGGCTGTACTATGGT
GACCATGCCTCCTTCACGTGCAATACTGGGTATGACATTCAGGGGAATAC
CAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTACAGCACCTTCAT
GCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCTGATGGTGCCATG
AGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTCCTGCAAGACTGG
GTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGGCCACTCAAACAT
GGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGCAGCTCTCTCCTC
GCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACTTATGGTGACAC
AGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGGTGACAGCGTCA
GGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGCCTCTTTGTCAA
AGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGATTATGTGGGAAC
TATCTGCTACAACGACACTATCACCTTCAACTGTGACCCCGGCTACGAGA
TGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTCATTGGGACACG
GCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTCCCCAGTGATCCC
CAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAATGATGTGGGCC
TGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAACGATATCCTTTAC
TGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAATGTCAATTAAT
GTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAGTAAGCTATACGG
GACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGACAACGGATTCACT
CTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGGCGACTGGGGACC
ATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAAACACCCTGTCAG
CTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCCCAGGGAACGGAC
CTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAAGGACTACTCCAA
CCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCAGCTGGAAGTGGA
TGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTCATTGATGTCAAT
GTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTTTGCTGCCGTGGT
TGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTGACATGGCAGCTG
TTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAACCTCTGCACTTTG
CCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCCTACGGCCAGAGT
GGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTGCCACCATGTCAG
TCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACCGCAACGAACACA
GTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAGTGAAGTGATGAC
AACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCCAGGGAGTGGAAG
TTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCAAGTCTGGGATGC
CAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAAGTGTGGCCAAGG
CACATACTATGACATATACGAGAACGACTGTCGCCCGTGTCCGTACGCCA
CTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCATGCAAGGAGGGA
ACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCAGTGTCAAGCTTT
TGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGACCGACTCAGCAG
GATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCAGACATCGCAGGG
GAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCCAGACGTTTGTCC
AAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCTGTGAATGCTTAC
CAGGATTTGAGGAACCAAACTGTATCGATATCGATGAGTGTCGGTATGTG
GGTTTCTGCCCAGATAACTCCGAATGTACCAACACACCCGGCAGTTACAA
CGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTCCTTGAAGTGTC
AGACTCTGACTATACCTGCCCACGGAACTGTACACATGGTCGGAGGGTCG
TTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGTACGAGGTGGT
CGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGGAGTGGAAATG
AACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCGCTCCCCTCAAT
GGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTGACATATGACTG
CAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGACCTGTCAGAGTG
ACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGACTGCAGTGTCCA
CAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGGCTGTACTATGG
TGACCATGCCTCCTTCACGTGCAATACTGGGTATGACATTCAGGGGAATA
CCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTACAGCACCTTCA
TGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCTGATGGTGCCAT
GAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTCCTGCAAGACTG
GGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGGCCACTCAAACA
TGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGCAGCTCTCTCCT
CGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACTTATGGTGACA
CAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGGTGACAGCGTC
AGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGCCTCTTTGTCA
AAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGATTATGTGGGAA
CTATCTGCTACAACGACACTATCACCTTCAACTGTGACCCCGGCTACGAG
ATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTCATTGGGACAC
GGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTCCCCAGTGATCC
CCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAATGATGTGGGC
CTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAACGATATCCTTTA
CTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAATGTCAATTAA
TGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAGTAAGCTATACG
GGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGACAACGGATTCAC
TCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGGCGACTGGGGAC
CATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAAACACCCTGTCA
GCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCCCAGGGAACGGA
CCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAAGGACTACTCCA
ACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCAGCTGGAAGTGG
ATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTCATTGATGTCAA
TGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTTTGCTGCCGTGG
TTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTGACATGGCAGCT
GTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAACCTCTGCACTTT
GCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCCTACGGCCAGAG
TGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTGCCACCATGTCA
GTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACCGCAACGAACAC
AGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAGTGAAGTGATGA
CAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCCAGGGAGTGGAA
GTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCAAGTCTGGGATG
CCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAAGTGTGGCCAAG
GCACATACTATGACATATACGAGAACGACTGTCGCCCGTGTCCGTACGCC
ACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCATGCAAGGAGGG
AACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCAGTGTCAAGCTT
TTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGACCGACTCAGCA
GGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCAGACATCGCAGG
GGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCCAGACGTTTGTC
CAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCTGTGAATGCTTA
CCAGGATTTGAGGAACCAAACTGTATCGATATCGATGAGTGTCGGTATGT
GGGTTTCTGCCCAGATAACTCCGAATGTACCAACACACCCGGCAGTTACA
ACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTCCTTGAAGTGT
CAGACTCTGACTATACCTGCCCACGGAACTGTACACATGGTCGGAGGGTC
GTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGTACGAGGTGG
TCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGGAGTGGAAAT
GAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCGCTCCCCTCAA
TGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTGACATATGACT
GCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGACCTGTCAGAGT
GACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGACTGCAGTGTCC
ACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGGCTGTACTATG
GTGACCATGCCTCCTTCACGTGCAATACTGGGTATGACATTCAGGGGAAT
ACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTACAGCACCTTC
ATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCTGATGGTGCCA
TGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTCCTGCAAGACT
GGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGGCCACTCAAAC
ATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGCAGCTCTCTCC
TCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACTTATGGTGAC
ACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGGTGACAGCGT
CAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGCCTCTTTGTC
AAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGATTATGTGGGA
ACTATCTGCTACAACGACACTATCACCTTCAACTGTGACCCCGGCTACGA
GATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTCATTGGGACA
CGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTCCCCAGTGATC
CCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAATGATGTGGG
CCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAACGATATCCTTT
ACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAATGTCAATTA
ATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAGTAAGCTATAC
GGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGACAACGGATTCA
CTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGGCGACTGGGGA
CCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAAACACCCTGTC
AGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCCCAGGGAACGG
ACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAAGGACTACTCC
AACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCAGCTGGAAGTG
GATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTCATTGATGTCA
ATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTTTGCTGCCGTG
GTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTGACATGGCAGC
TGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAACCTCTGCACTT
TGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCCTACGGCCAGA
GTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTGCCACCATGTC
AGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACCGCAACGAACA
CAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAGTGAAGTGATG
ACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCCAGGGAGTGGA
AGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCAAGTCTGGGAT
GCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAAGTGTGGCCAA
GGCACATACTATGACATATACGAGAACGACTGTCGCCCGTGTCCGTACGC
CACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCATGCAAGGAGG
GAACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCAGTGTCAAGCT
TTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGACCGACTCAGC
AGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCAGACATCGCAG
GGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCCAGACGTTTGT
CCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCTGTGAATGCTT
ACCAGGATTTGAGGAACCAAACTGTATCGATATCGATGAGTGTCGGTATG
TGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACACCCGGCAGTTAC
AACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTCCTTGAAGTG
TCAGACTCTGACTATACCTGCCCACGGAACTGTACACATGGTCGGAGGGT
CGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGTACGAGGTG
GTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGGAGTGGAAA
TGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCGCTCCCCTCA
ATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTGACATATGAC
TGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGACCTGTCAGAG
TGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGACTGCAGTGTC
CACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGGCTGTACTAT
GGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGACATTCAGGGGAA
TACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTACAGCACCTT
CATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCTGATGGTGCC
ATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTCCTGCAAGAC
TGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGGCCACTCAAA
CATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGCAGCTCTCTC
CTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACTTATGGTGA
CACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGGTGACAGCG
TCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGCCTCTTTGT
CAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGATTATGTGGG
AACTATCTGCTACAACGACACTATCACCTTCAACTGTGACCCCGGCTACG
AGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTCATTGGGAC
ACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTCCCCAGTGAT
CCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAATGATGTGG
GCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAACGATATCCTT
TACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAATGTCAATT
AATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAGTAAGCTATA
CGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGACAACGGATTC
ACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGGCGACTGGGG
ACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAAACACCCTGT
CAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCCCAGGGAACG
GACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAAGGACTACTC
CAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCAGCTGGAAGT
GGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTCATTGATGTC
AATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTTTGCTGCCGT
GGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTGACATGGCAG
CTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAACCTCTGCACT
TTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCCTACGGCCAG
AGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTGCCACCATGT
CAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACCGCAACGAAC
ACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAGTGAAGTGAT
GACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCCAGGGAGTGG
AAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCAAGTCTGGGA
TGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAAGTGTGGCCA
AGGCACATACTATGACATATACGAGAACGACTGTCGCCCGTGTCCGTACG
CCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCATGCAAGGAG
GGAACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCAGTGTCAAGC
TTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGACCGACTCAG
CAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCAGACATCGCA
GGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCCAGACGTTTG
TCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCTGTGAATGCT
TACCAGGATTTGAGGAACCAAACTGTATCGATATCGATGAGTGTCGGTAT
GTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACACCCGGCAGTTA
CAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTCCTTGAAGT
GTCAGACTCTGACTATACCTGCCCACGGAACTGTACACATGGTCGGAGGG
TCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGTACGAGGT
GGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGGAGTGGAA
ATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCGCTCCCCTC
AATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTGACATATGA
CTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGACCTGTCAGA
GTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGACTGCAGTGT
CCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGGCTGTACTA
TGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGACATTCAGGGGA
ATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTACAGCACCT
TCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCTGATGGTGC
CATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTCCTGCAAGA
CTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGGCCACTCAA
ACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGCAGCTCTCT
CCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACTTATGGTG
ACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGGTGACAGC
GTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGCCTCTTTG
TCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGATTATGTGG
GAACTATCTGCTACAACGACACTATCACCTTCAACTGTGACCCCGGCTAC
GAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTCATTGGGA
CACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTCCCCAGTGA
TCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAATGATGTG
GGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAACGATATCCT
TTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAATGTCAAT
TAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAGTAAGCTAT
ACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGACAACGGATT
CACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGGCGACTGGG
GACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAAACACCCTG
TCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCCCAGGGAAC
GGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAAGGACTACT
CCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCAGCTGGAAG
TGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTCATTGATGT
CAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTTTGCTGCCG
TGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTGACATGGCA
GCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAACCTCTGCAC
TTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCCTACGGCCA
GAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTGCCACCATG
TCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACCGCAACGAA
CACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAGTGAAGTGA
TGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCCAGGGAGTG
GAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCAAGTCTGGG
ATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAAGTGTGGCC
AAGGCACATACTATGACATATACGAGAACGACTGTCGCCCGTGTCCGTAC
GCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCATGCAAGGA
GGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCAGTGTCAAG
CTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGACCGACTCA
GCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCAGACATCGC
AGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCCAGACGTTT
GTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCTGTGAATGC
TTACCAGGATTTGAGGAACCAAACTGTATCGATATCGATGAGTGTCGGTA
TGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACACCCGGCAGTT
ACAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTCCTTGAAG
TGTCAGACTCTGACTATACCTGCCCACGGAACTGTACACATGGTCGGAGG
GTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGTACGAGG
TGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGGAGTGGA
AATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCGCTCCCCT
CAATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTGACATATG
ACTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGACCTGTCAG
AGTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGACTGCAGTG
TCCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGGCTGTACT
ATGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGACATTCAGGGG
AATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTACAGCACC
TTCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCTGATGGTG
CCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTCCTGCAAG
ACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGGCCACTCA
AACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGCAGCTCTC
TCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACTTATGGT
GACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGGTGACAG
CGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGCCTCTTT
GTCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGATTATGTG
GGAACTATCTGCTACAACGACACTATCACCTTCAACTGTGACCCCGGCTA
CGAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTCATTGGG
ACACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTCCCCAGTG
ATCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAATGATGT
GGGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAACGATATCC
TTTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAATGTCAA
TTAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAGTAAGCTA
TACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGACAACGGAT
TCACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGGCGACTGG
GGACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAAACACCCT
GTCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCCCAGGGAA
CGGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAAGGACTAC
TCCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCAGCTGGAA
GTGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTCATTGATG
TCAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTTTGCTGCC
GTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTGACATGGC
AGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAACCTCTGCA
CTTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCCTACGGCC
AGAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTGCCACCAT
GTCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACCGCAACGA
ACACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAGTGAAGTG
ATGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCCAGGGAGT
GGAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCAAGTCTGG
GATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAAGTGTGGC
CAAGGCACATACTATGACATATACGAGAACGACTGTCGCCCGTGTCCGTA
CGCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCATGCAAGG
AGGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCAGTGTCAA
GCTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGACCGACTC
AGCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCAGACATCG
CAGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCCAGACGTT
TGTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCTGTGAATG
CTTACCAGGATTTGAGGAACCAAACTGTATCGATATCGATGAGTGTCGGT
ATGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACACCCGGCAGT
TACAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTCCTTGAA
GTGTCAGACTCTGACTATACCTGCCCACGGAACTGTACACATGGTCGGAG
GGTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGTACGAG
GTGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGGAGTGG
AAATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCGCTCCCC
TCAATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTGACATAT
GACTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGACCTGTCA
GAGTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGACTGCAGT
GTCCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGGCTGTAC
TATGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGACATTCAGGG
GAATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTACAGCAC
CTTCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCTGATGGT
GCCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTCCTGCAA
GACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGGCCACTC
AAACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGCAGCTCT
CTCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACTTATGG
TGACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGGTGACA
GCGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGCCTCTT
TGTCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGATTATGT
GGGAACTATCTGCTACAACGACACTATCACCTTCAACTGTGACCCCGGCT
ACGAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTCATTGG
GACACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTCCCCAGT
GATCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAATGATG
TGGGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAACGATATC
CTTTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAATGTCA
ATTAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAGTAAGCT
ATACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGACAACGGA
TTCACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGGCGACTG
GGGACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAAACACCC
TGTCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCCCAGGGA
ACGGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAAGGACTA
CTCCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCAGCTGGA
AGTGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTCATTGAT
GTCAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTTTGCTGC
CGTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTGACATGG
CAGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAACCTCTGC
ACTTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCCTACGGC
CAGAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTGCCACCA
TGTCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACCGCAACG
AACACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAGTGAAGT
GATGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCCAGGGAG
TGGAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCAAGTCTG
GGATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAAGTGTGG
CCAAGGCACATACTATGACATATACGAGAACGACTGTCGCCCGTGTCCGT
ACGCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCATGCAAG
GAGGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCAGTGTCA
AGCTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGACCGACT
CAGCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCAGACATC
GCAGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCCAGACGT
TTGTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCTGTGAAT
GCTTACCAGGATTTGAGGAACCAAACTGTATCGATATCGATGAGTGTCGG
TATGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACACCCGGCAG
TTACAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTCCTTGA
AGTGTCAGACTCTGACTATACCTGCCCACGGAACTGTACACATGGTCGGA
GGGTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGTACGA
GGTGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGGAGTG
GAAATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCGCTCCC
CTCAATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTGACATA
TGACTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGACCTGTC
AGAGTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGACTGCAG
TGTCCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGGCTGTA
CTATGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGACATTCAGG
GGAATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTACAGCA
CCTTCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCTGATGG
TGCCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTCCTGCA
AGACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGGCCACT
CAAACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGCAGCTC
TCTCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACTTATG
GTGACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGGTGAC
AGCGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGCCTCT
TTGTCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGATTATG
TGGGAACTATCTGCTACAACGACACTATCACCTTCAACTGTGACCCCGGC
TACGAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTCATTG
GGACACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTCCCCAG
TGATCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAATGAT
GTGGGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAACGATAT
CCTTTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAATGTC
AATTAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAGTAAGC
TATACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGACAACGG
ATTCACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGGCGACT
GGGGACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAAACACC
CTGTCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCCCAGGG
AACGGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAAGGACT
ACTCCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCAGCTGG
AAGTGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTCATTGA
TGTCAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTTTGCTG
CCGTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTGACATG
GCAGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAACCTCTG
CACTTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCCTACGG
CCAGAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTGCCACC
ATGTCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACCGCAAC
GAACACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAGTGAAG
TGATGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCCAGGGA
GTGGAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCAAGTCT
GGGATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAAGTGTG
GCCAAGGCACATACTATGACATATACGAGAACGACTGTCGCCCGTGTCCG
TACGCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCATGCAA
GGAGGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCAGTGTC
AAGCTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGACCGAC
TCAGCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCAGACAT
CGCAGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCCAGACG
TTTGTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCTGTGAA
TGCTTACCAGGATTTGAGGAACCAAACTGTATCGATATCGATGAGTGTCG
GTATGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACACCCGGCA
GTTACAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTCCTTG
AAGTGTCAGACTCTGACTATACCTGCCCACGGAACTGTACACATGGTCGG
AGGGTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGTACG
AGGTGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGGAGT
GGAAATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCGCTCC
CCTCAATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTGACAT
ATGACTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGACCTGT
CAGAGTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGACTGCA
GTGTCCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGGCTGT
ACTATGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGACATTCAG
GGGAATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTACAGC
ACCTTCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCTGATG
GTGCCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTCCTGC
AAGACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGGCCAC
TCAAACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGCAGCT
CTCTCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACTTAT
GGTGACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGGTGA
CAGCGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGCCTC
TTTGTCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGATTAT
GTGGGAACTATCTGCTACAACGACACTATCACCTTCAACTGTGACCCCGG
CTACGAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTCATT
GGGACACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTCCCCA
GTGATCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAATGA
TGTGGGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAACGATA
TCCTTTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAATGT
CAATTAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAGTAAG
CTATACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGACAACG
GATTCACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGGCGAC
TGGGGACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAAACAC
CCTGTCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCCCAGG
GAACGGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAAGGAC
TACTCCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCAGCTG
GAAGTGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTCATTG
ATGTCAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTTTGCT
GCCGTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTGACAT
GGCAGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAACCTCT
GCACTTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCCTACG
GCCAGAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTGCCAC
CATGTCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACCGCAA
CGAACACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAGTGAA
GTGATGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCCAGGG
AGTGGAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCAAGTC
TGGGATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAAGTGT
GGCCAAGGCACATACTATGACATATACGAGAACGACTGTCGCCCGTGTCC
GTACGCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCATGCA
AGGAGGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCAGTGT
CAAGCTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGACCGA
CTCAGCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCAGACA
TCGCAGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCCAGAC
GTTTGTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCTGTGA
ATGCTTACCAGGATTTGAGGAACCAAACTGTATCGATATCGATGAGTGTC
GGTATGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACACCCGGC
AGTTACAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTCCTT
GAAGTGTCAGACTCTGACTATACCTGCCCACGGAACTGTACACATGGTCG
GAGGGTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGTAC
GAGGTGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGGAG
TGGAAATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCGCTC
CCCTCAATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTGACA
TATGACTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGACCTG
TCAGAGTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGACTGC
AGTGTCCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGGCTG
TACTATGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGACATTCA
GGGGAATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTACAG
CACCTTCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCTGAT
GGTGCCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTCCTG
CAAGACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGGCCA
CTCAAACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGCAGC
TCTCTCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACTTA
TGGTGACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGGTG
ACAGCGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGCCT
CTTTGTCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGATTA
TGTGGGAACTATCTGCTACAACGACACTATCACCTTCAACTGTGACCCCG
GCTACGAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTCAT
TGGGACACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTCCCC
AGTGATCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAATG
ATGTGGGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAACGAT
ATCCTTTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAATG
TCAATTAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAGTAA
GCTATACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGACAAC
GGATTCACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGGCGA
CTGGGGACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAAACA
CCCTGTCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCCCAG
GGAACGGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAAGGA
CTACTCCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCAGCT
GGAAGTGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTCATT
GATGTCAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTTTGC
TGCCGTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTGACA
TGGCAGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAACCTC
TGCACTTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCCTAC
GGCCAGAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTGCCA
CCATGTCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACCGCA
ACGAACACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAGTGA
AGTGATGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCCAGG
GAGTGGAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCAAGT
CTGGGATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAAGTG
TGGCCAAGGCACATACTATGACATATACGAGAACGACTGTCGCCCGTGTC
CGTACGCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCATGC
AAGGAGGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCAGTG
TCAAGCTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGACCG
ACTCAGCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCAGAC
ATCGCAGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCCAGA
CGTTTGTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCTGTG
AATGCTTACCAGGATTTGAGGAACCAAACTGTATCGATATCGATGAGTGT
CGGTATGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACACCCGG
CAGTTACAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTCCT
TGAAGTGTCAGACTCTGACTATACCTGCCCACGGAACTGTACACATGGTC
GGAGGGTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGTA
CGAGGTGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGGA
GTGGAAATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCGCT
CCCCTCAATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTGAC
ATATGACTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGACCT
GTCAGAGTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGACTG
CAGTGTCCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGGCT
GTACTATGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGACATTC
AGGGGAATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTACA
GCACCTTCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCTGA
TGGTGCCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTCCT
GCAAGACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGGCC
ACTCAAACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGCAG
CTCTCTCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACTT
ATGGTGACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGGT
GACAGCGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGCC
TCTTTGTCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGATT
ATGTGGGAACTATCTGCTACAACGACACTATCACCTTCAACTGTGACCCC
GGCTACGAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTCA
TTGGGACACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTCCC
CAGTGATCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAAT
GATGTGGGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAACGA
TATCCTTTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAAT
GTCAATTAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAGTA
AGCTATACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGACAA
CGGATTCACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGGCG
ACTGGGGACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAAAC
ACCCTGTCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCCCA
GGGAACGGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAAGG
ACTACTCCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCAGC
TGGAAGTGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTCAT
TGATGTCAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTTTG
CTGCCGTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTGAC
ATGGCAGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAACCT
CTGCACTTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCCTA
CGGCCAGAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTGCC
ACCATGTCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACCGC
AACGAACACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAGTG
AAGTGATGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCCAG
GGAGTGGAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCAAG
TCTGGGATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAAGT
GTGGCCAAGGCACATACTATGACATATACGAGAACGACTGTCGCCCGTGT
CCGTACGCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCATG
CAAGGAGGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCAGT
GTCAAGCTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGACC
GACTCAGCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCAGA
CATCGCAGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCCAG
ACGTTTGTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCTGT
GAATGCTTACCAGGATTTGAGGAACCAAACTGTATCGATATCGATGAGTG
TCGGTATGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACACCCG
GCAGTTACAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTCC
TTGAAGTGTCAGACTCTGACTATACCTGCCCACGGAACTGTACACATGGT
CGGAGGGTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGGT
ACGAGGTGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATGG
AGTGGAAATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCGC
TCCCCTCAATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTGA
CATATGACTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGACC
TGTCAGAGTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGACT
GCAGTGTCCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGGC
TGTACTATGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGACATT
CAGGGGAATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTAC
AGCACCTTCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCTG
ATGGTGCCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTCC
TGCAAGACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGGC
CACTCAAACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGCA
GCTCTCTCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACACT
TATGGTGACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCGG
TGACAGCGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACGC
CTCTTTGTCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGAT
TATGTGGGAACTATCTGCTACAACGACACTATCACCTTCAACTGTGACCC
CGGCTACGAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGTC
ATTGGGACACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTCC
CCAGTGATCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCAA
TGATGTGGGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAACG
ATATCCTTTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCAA
TGTCAATTAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAGT
AAGCTATACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGACA
ACGGATTCACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGGC
GACTGGGGACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAAA
CACCCTGTCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCCC
AGGGAACGGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAAG
GACTACTCCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCAG
CTGGAAGTGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTCA
TTGATGTCAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTTT
GCTGCCGTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTGA
CATGGCAGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAACC
TCTGCACTTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCCT
ACGGCCAGAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTGC
CACCATGTCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACCG
CAACGAACACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAGT
GAAGTGATGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCCA
GGGAGTGGAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCAA
GTCTGGGATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAAG
TGTGGCCAAGGCACATACTATGACATATACGAGAACGACTGTCGCCCGTG
TCCGTACGCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCAT
GCAAGGAGGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCAG
TGTCAAGCTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGAC
CGACTCAGCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCAG
ACATCGCAGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCCA
GACGTTTGTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCTG
TGAATGCTTACCAGGATTTGAGGAACCAAACTGTATCGATATCGATGAGT
GTCGGTATGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACACCC
GGCAGTTACAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACTC
CTTGAAGTGTCAGACTCTGACTATACCTGCCCACGGAACTGTACACATGG
TCGGAGGGTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGGG
TACGAGGTGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACATG
GAGTGGAAATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCCG
CTCCCCTCAATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGTG
ACATATGACTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGAC
CTGTCAGAGTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGAC
TGCAGTGTCCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGGG
CTGTACTATGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGACAT
TCAGGGGAATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGTA
CAGCACCTTCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGCT
GATGGTGCCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCTC
CTGCAAGACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAGG
CCACTCAAACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTGC
AGCTCTCTCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACAC
TTATGGTGACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATCG
GTGACAGCGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCACG
CCTCTTTGTCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTGA
TTATGTGGGAACTATCTGCTACAACGACACTATCACCTTCAACTGTGACC
CCGGCTACGAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGGT
CATTGGGACACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTTC
CCCAGTGATCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTCA
ATGATGTGGGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAAC
GATATCCTTTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCCA
ATGTCAATTAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCAG
TAAGCTATACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGAC
AACGGATTCACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTGG
CGACTGGGGACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGAA
ACACCCTGTCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCCC
CAGGGAACGGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGAA
GGACTACTCCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACCA
GCTGGAAGTGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTTC
ATTGATGTCAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGTT
TGCTGCCGTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTTG
ACATGGCAGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAAC
CTCTGCACTTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATCC
TACGGCCAGAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGTG
CCACCATGTCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTACC
GCAACGAACACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTAG
TGAAGTGATGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTCC
AGGGAGTGGAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACCA
AGTCTGGGATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAAA
GTGTGGCCAAGGCACATACTATGACATATACGAGAACGACTGTCGCCCGT
GTCCGTACGCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACCA
TGCAAGGAGGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCACCCA
GTGTCAAGCTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTGA
CCGACTCAGCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGCA
GACATCGCAGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGCC
AGACGTTTGTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCCT
GTGAATGCTTACCAGGATTTGAGGAACCAAACTGTATCGATATCGATGAG
TGTCGGTATGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACACC
CGGCAGTTACAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTACT
CCTTGAAGTGTCAGACTCTGACTATACCTGCCCACGGAACTGTACACATG
GTCGGAGGGTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTGG
GTACGAGGTGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACAT
GGAGTGGAAATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGCC
GCTCCCCTCAATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGGT
GACATATGACTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGGA
CCTGTCAGAGTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAGA
CTGCAGTGTCCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTGG
GCTGTACTATGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGACA
TTCAGGGGAATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAGT
ACAGCACCTTCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAGC
TGATGGTGCCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTCT
CCTGCAAGACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCAG
GCCACTCAAACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTTG
CAGCTCTCTCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAACA
CTTATGGTGACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGATC
GGTGACAGCGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCAC
GCCTCTTTGTCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGTG
ATTATGTGGGAACTATCTGCTACAACGACACTATCACCTTCAACTGTGAC
CCCGGCTACGAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTGG
TCATTGGGACACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGTT
CCCCAGTGATCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTTC
AATGATGTGGGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAAA
CGATATCCTTTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCCC
AATGTCAATTAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGCA
GTAAGCTATACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTGA
CAACGGATTCACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGTG
GCGACTGGGGACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAGA
AACACCCTGTCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCCC
CCAGGGAACGGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGGA
AGGACTACTCCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAACC
AGCTGGAAGTGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTTT
CATTGATGTCAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCGT
TTGCTGCCGTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGTT
GACATGGCAGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATAA
CCTCTGCACTTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGATC
CTACGGCCAGAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCGT
GCCACCATGTCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTAC
CGCAACGAACACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTTA
GTGAAGTGATGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGTC
CAGGGAGTGGAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCACC
AAGTCTGGGATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGAA
AGTGTGGCCAAGGCACATACTATGACATATACGAGAACGACTGTCGCCCG
TGTCCGTACGCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAACC
ATGCAAGGAGGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCACCC
AGTGTCAAGCTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCTG
ACCGACTCAGCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGGC
AGACATCGCAGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAGC
CAGACGTTTGTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTCC
TGTGAATGCTTACCAGGATTTGAGGAACCAAACTGTATCGATATCGATGA
GTGTCGGTATGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACAC
CCGGCAGTTACAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTAC
TCCTTGAAGTGTCAGACTCTGACTATACCTGCCCACGGAACTGTACACAT
GGTCGGAGGGTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCTG
GGTACGAGGTGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGACA
TGGAGTGGAAATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGGC
CGCTCCCCTCAATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACGG
TGACATATGACTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAGG
ACCTGTCAGAGTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAAG
ACTGCAGTGTCCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGTG
GGCTGTACTATGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGAC
ATTCAGGGGAATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCAG
TACAGCACCTTCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCAG
CTGATGGTGCCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATTC
TCCTGCAAGACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCCA
GGCCACTCAAACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACTT
GCAGCTCTCTCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAAC
ACTTATGGTGACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGAT
CGGTGACAGCGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCCA
CGCCTCTTTGTCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGGT
GATTATGTGGGAACTATCTGCTACAACGACACTATCACCTTCAACTGTGA
CCCCGGCTACGAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACTG
GTCATTGGGACACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAGT
TCCCCAGTGATCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTTT
CAATGATGTGGGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGAA
ACGATATCCTTTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCCC
CAATGTCAATTAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTGC
AGTAAGCTATACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGTG
ACAACGGATTCACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAGT
GGCGACTGGGGACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACAG
AAACACCCTGTCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGCC
CCCAGGGAACGGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGGG
AAGGACTACTCCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAAC
CAGCTGGAAGTGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGTT
TCATTGATGTCAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCCG
TTTGCTGCCGTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCGT
TGACATGGCAGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAATA
ACCTCTGCACTTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGAT
CCTACGGCCAGAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCCG
TGCCACCATGTCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATTA
CCGCAACGAACACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACTT
AGTGAAGTGATGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAGT
CCAGGGAGTGGAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCAC
CAAGTCTGGGATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAGA
AAGTGTGGCCAAGGCACATACTATGACATATACGAGAACGACTGTCGCCC
GTGTCCGTACGCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAAC
CATGCAAGGAGGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCACC
CAGTGTCAAGCTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGCT
GACCGACTCAGCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAGG
CAGACATCGCAGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCAG
CCAGACGTTTGTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACTC
CTGTGAATGCTTACCAGGATTTGAGGAACCAAACTGTATCGATATCGATG
AGTGTCGGTATGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACACA
CCCGGCAGTTACAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTTA
CTCCTTGAAGTGTCAGACTCTGACTATACCTGCCCACGGAACTGTACACA
TGGTCGGAGGGTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGCT
GGGTACGAGGTGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGAC
ATGGAGTGGAAATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTGG
CCGCTCCCCTCAATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACACG
GTGACATATGACTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAAG
GACCTGTCAGAGTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAAA
GACTGCAGTGTCCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGGT
GGGCTGTACTATGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATGA
CATTCAGGGGAATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGCA
GTACAGCACCTTCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCCA
GCTGATGGTGCCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACATT
CTCCTGCAAGACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGCC
AGGCCACTCAAACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTACT
TGCAGCTCTCTCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGAA
CACTTATGGTGACACAGCAACAATTTCATGTGAACCTGGATACGAGCTGA
TCGGTGACAGCGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTCC
ACGCCTCTTTGTCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTGG
TGATTATGTGGGAACTATCTGCTACAACGACACTATCACCTTCAACTGTG
ACCCCGGCTACGAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGACT
GGTCATTGGGACACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACAG
TTCCCCAGTGATCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGTT
TCAATGATGTGGGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGGA
AACGATATCCTTTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGCC
CCAATGTCAATTAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGTG
CAGTAAGCTATACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTGT
GACAACGGATTCACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAAG
TGGCGACTGGGGACCATCACCTTACTGTCAACCTTACAGCTTGTGTGACA
GAAACACCCTGTCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAGC
CCCCAGGGAACGGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCGG
GAAGGACTACTCCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCAA
CCAGCTGGAAGTGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAGT
TTCATTGATGTCAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACCC
GTTTGCTGCCGTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCCG
TTGACATGGCAGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAAT
AACCTCTGCACTTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTGA
TCCTACGGCCAGAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGCC
GTGCCACCATGTCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCATT
ACCGCAACGAACACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAACT
TAGTGAAGTGATGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACAG
TCCAGGGAGTGGAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCCA
CCAAGTCTGGGATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTAG
AAAGTGTGGCCAAGGCACATACTATGACATATACGAGAACGACTGTCGCC
CGTGTCCGTACGCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAAA
CCATGCAAGGAGGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCAC
CCAGTGTCAAGCTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAGC
TGACCGACTCAGCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACAG
GCAGACATCGCAGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGCA
GCCAGACGTTTGTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTACT
CCTGTGAATGCTTACCAGGATTTGAGGAACCAAACTGTATCGATATCGAT
GAGTGTCGGTATGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACAC
ACCCGGCAGTTACAACGATGGAACCTGGACAGGAATCCAGCCAGTTTGTT
ACTCCTTGAAGTGTCAGACTCTGACTATACCTGCCCACGGAACTGTACAC
ATGGTCGGAGGGTCGTTGTTTGGTGGCACCGCCACGTACTCCTGTGATGC
TGGGTACGAGGTGGTCGGGACCCCCGTCAGGATGTGCCAAGCTAGCAGGA
CATGGAGTGGAAATGAACCAACTTGTGAAAAAATATCCTGTGTTAGCCTG
GCCGCTCCCCTCAATGGTGGGATCAGCGGGTTCAACCAGTACGGAGACAC
GGTGACATATGACTGCAGCACTGGGTTTCAGTTAGTGGGTGACCAGACAA
GGACCTGTCAGAGTGACCAGCAGTGGAGTGGAACACAGCCTCACTGTCAA
AGACTGCAGTGTCCACAGCTTGGTACGATCGCAAACGGTGGCTACACAGG
TGGGCTGTACTATGGTGACCATGCCTCCTTCACGTGCAATACTGGGTATG
ACATTCAGGGGAATACCAGTGCAGTTTGCATGGACAACGGACAATGGAGC
AGTACAGCACCTTCATGCATAGCACAAGAATGTCCTCCCCTGACAGCCCC
AGCTGATGGTGCCATGAGTGGAACCTTTTTTGTGGGTGACAGGGTGACAT
TCTCCTGCAAGACTGGGTTTGACTTGGTGGGCAGCAATGTCATTGTGTGC
CAGGCCACTCAAACATGGAGTGGAACTGAACCAAAATGTCAAAGTGTTAC
TTGCAGCTCTCTCCTCGCCCCTGTGTATGGGAGTGTAAGAGCCCCAGGGA
ACACTTATGGTGACACAGCAACAATTTCATGTGAACCTGGATACGAGCTG
ATCGGTGACAGCGTCAGGACGTGTGAAGCCAGCGGACTGTGGAGTGGTTC
CACGCCTCTTTGTCAAAGGAAATGCTGTAGTGCTCTGTCCGTTCCGTTTG
GTGATTATGTGGGAACTATCTGCTACAACGACACTATCACCTTCAACTGT
GACCCCGGCTACGAGATGTTTGGAGCGACGGGGGCAACATGTAACGAGAC
TGGTCATTGGGACACGGCAGTTCCCCAGTGTCAAAAGGTGTGCTGTAACA
GTTCCCCAGTGATCCCCAACGGCCAGCTGACTACTGCACGTGGCAACTGT
TTCAATGATGTGGGCCTGGTAGACTGCTCGGTAGGCTACGTAAACTATGG
AAACGATATCCTTTACTGCAACGCAAGTGGACAATGGGAGGGAAAGATGC
CCCAATGTCAATTAATGTGCTGTGGAGACCCAGGGTCCATCCGGGATGGT
GCAGTAAGCTATACGGGACTGTGCTACGGTGATGTTGCAACCTACTCGTG
TGACAACGGATTCACTCTTGTGGGCAATGCAACATACACCTGTTCTGCAA
GTGGCGACTGGGGACCATCACCTTACTGTCAACCTTACAGCTTGTGTGAC
AGAAACACCCTGTCAGCTCCACACGGAGGCACCAAGATCTGTTTTGACAG
CCCCCAGGGAACGGACCTCATAGAGTACTGCCAGATGCACTGCAACGCCG
GGAAGGACTACTCCAACCATAATGAGGCTCTGTATGAATGTAGCGCTGCA
ACCAGCTGGAAGTGGATGGTTCGTCGCTTTGTGCCAGGCGGCTTCAGCAG
TTTCATTGATGTCAATGTTGGGATTTGTTCTGCCGCAGCCTATTTCAACC
CGTTTGCTGCCGTGGTTGCCAACGGTCTGACCATCACCTTCTCCGGAGCC
GTTGACATGGCAGCTGTTGAGGCAGAGATGAAGAACTACCTCCTCACCAA
TAACCTCTGCACTTTGCCATGTCAGGTTAGCAACATTGAGCTGCAAATTG
ATCCTACGGCCAGAGTGGGACCACGAGCAAAGGCTGCCAGATCTAACAGC
CGTGCCACCATGTCAGTCCAACTCTACGCCTACGCAGACGAGAGCCGCAT
TACCGCAACGAACACAGTTCAGATGGAGTGGGTTCGTCTGGCTGGAGAAC
TTAGTGAAGTGATGACAACCCTCCAACAGCCAGGAGGGATCACTCTGACA
GTCCAGGGAGTGGAAGTTGTGCTTCATGCTGAAAATATGCAGATCTCCCC
ACCAAGTCTGGGATGCCAGCTGGGAGAAGTACAGGAGGGGGTTCGGTGTA
GAAAGTGTGGCCAAGGCACATACTATGACATATACGAGAACGACTGTCGC
CCGTGTCCGTACGCCACTTACCAAGACGAGTCGGGACAGACCGAGTGCAA
ACCATGCAAGGAGGGAACCACAACTGCCATGATGAGTGCCCGTAACTCCA
CCCAGTGTCAAGCTTTTGCTGAGTGCAACTGTGGCATCCATCCGTGCAAG
CTGACCGACTCAGCAGGATACGTGTGTGATTGTCTGGATGGGTACGAACA
GGCAGACATCGCAGGGGAATTACTGTGCAAAGACATCGATGAGTGTATGC
AGCCAGACGTTTGTCCAAACGCTGCATGCCACAACCGCCCGGGGACCTAC
TCCTGTGAATGCTTACCAGGATTTGAGGAACCAAACTGTATCGATATCGA
TGAGTGTCGGTATGTGGGTTTCTGCCCAGATAACTCCGAATGTACCAACA
CACCCGGCAGTTACAAC
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97350gene:BL97350Branchiostoma lanceolatumgene
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97350_cuf3-E1BL97350_cuf3-E1-1564476830-290933Branchiostoma lanceolatumexon
BL97350_cuf3-E2BL97350_cuf3-E2-1564476830-290930Branchiostoma lanceolatumexon
BL97350_cuf3-E3BL97350_cuf3-E3-1564476830-290928Branchiostoma lanceolatumexon
BL97350_cuf3-E4BL97350_cuf3-E4-1564476830-290926Branchiostoma lanceolatumexon
BL97350_cuf3-E5BL97350_cuf3-E5-1564476830-290924Branchiostoma lanceolatumexon
BL97350_cuf3-E6BL97350_cuf3-E6-1564476830-290922Branchiostoma lanceolatumexon
BL97350_cuf3-E7BL97350_cuf3-E7-1564476830-290920Branchiostoma lanceolatumexon
BL97350_cuf3-E8BL97350_cuf3-E8-1564476830-290918Branchiostoma lanceolatumexon
BL97350_cuf3-E9BL97350_cuf3-E9-1564476830-290916Branchiostoma lanceolatumexon
BL97350_cuf3-E10BL97350_cuf3-E10-1564476830-290914Branchiostoma lanceolatumexon
BL97350_cuf3-E11BL97350_cuf3-E11-1564476830-290912Branchiostoma lanceolatumexon
BL97350_cuf3-E12BL97350_cuf3-E12-1564476830-290910Branchiostoma lanceolatumexon
BL97350_cuf3-E13BL97350_cuf3-E13-1564476830-290908Branchiostoma lanceolatumexon
BL97350_cuf3-E14BL97350_cuf3-E14-1564476830-290906Branchiostoma lanceolatumexon
BL97350_cuf3-E15BL97350_cuf3-E15-1564476830-290904Branchiostoma lanceolatumexon
BL97350_cuf3-E16BL97350_cuf3-E16-1564476830-290902Branchiostoma lanceolatumexon
BL97350_cuf3-E17BL97350_cuf3-E17-1564476830-290900Branchiostoma lanceolatumexon
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97350_cuf3transcript:BL97350_cuf3-proteinBranchiostoma lanceolatumpolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000091genomeSc0000091:603008..612979 -
Properties
Property NameValue
Transcript idBL97350_cuf3
Biotypeprotein_coding