Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97205_cuf19 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97205_cuf19
Unique Nametranscript:BL97205_cuf19
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97205_cuf19

>transcript:BL97205_cuf19-protein ID=transcript:BL97205_cuf19-protein|Name=transcript:BL97205_cuf19|organism=Branchiostoma lanceolatum|type=polypeptide|length=137bp
MTSYHSRKNLQQIVDALNQAQEHFGSEGSGDFQMFDSSEFEGRDLMFRDN
VQRLVPVGQRNTWQKWLGSSYMESVGHLISHDEQRNQHVLDKQVRWCVTS
DAEREKCEELSRVQKEGVSFPTVKCVQADNADQCGQM
Run BLAST on NCBI

mRNA from alignment at Sc0000043:1263379..1270465-

Legend: polypeptideexonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97205_cuf19 ID=transcript:BL97205_cuf19|Name=transcript:BL97205_cuf19|organism=Branchiostoma lanceolatum|type=mRNA|length=7087bp|location=Sequence derived from alignment at Sc0000043:1263379..1270465- (Branchiostoma lanceolatum)
ATGACCTCCTACCACAGCAGGAAGAACCTGCAGCAGATTGTGGATGCCCT CAACCAGGCACAGGTAGGAAGAGATACAGAAGTCATGTCTCAACATAGCC AACTTATTGGTACTCCAAGGTACTGTAAATGCATTTAAGTTCGAATGGTT TTTATTTCGCCCTTTCGAAAATGGAGTGTTCGCGATGGTTTTAAGTTTGT GGCAGCGCTATAGTTACATACTGCTACAGTATTGGACAAAAATGTTTGCG GGTTTTAAGTTCGCGGTGAAACGGTCGCCGCAAGAAACGTGAACAGAAAA CCACCGCGAACATTTCTGCATTTACAGTATACTGTAGTTTTATTTGCTTT TGAATTTCGTGAGGATTTTAGTTCATGGTAGGAGGGAAAAAAAGGTAGTA CAGAAGTAACGTTAATACATTAAAAACACATACAGTGTATTTGCAGAGAG GTCACTGCAAAAACCGTTATAGTAAAACCACCACAAAAGTTTTCAAGAAT AGATTTTCCACTACAAGCATAGATCTTGATTCCCTTTACTATTTCAGGAA CATTTTGGCTCGGAGGGCTCTGGTGATTTCCAGATGTTTGACTCCAGCGA GTTCGAAGGTCGTGACCTGATGTTCCGTGACAACGTGCAGCGCCTGGTCC CGGTGGGGCAGCGGAACACATGGCAGAAGTGGCTGGGCTCCAGCTATATG GAGTCTGTTGGTCACCTGATCAGCCATGATGAGCAGAGGAACCAGCGTGT TCTAAGTAAATATTTGTCCATGTATATGCACTATCTAACACCTGATGATA AAAATAACGTATTATCATTGATAAGCAAATTTACTCTTTTTCATCAATTT TCACTGTTCTTTATCTCTGCTCCGAGCTGATACTGATAAAAGTAAAAAGT CTTGTTGGTCTTATGTCATATTCAGATTTACACAATTTTACTCGGTTAAG TTTAATATATGACTTGAATTTGCATGTAACAAGTCATATTGAAATTGAAA TAGTAAAGAATATAGAATACAGAAGCATATCTGATAATGGTGATGATGAT ATGCCCATAGATAAGCAGATTCGCTGGTGTGCAACATCCGACGCTGAGAT GGAGAAGTGTGAGCGGCTGAGCAAGACCCTGACTGAGGGTGGTTTTGTCC CCACCGTCAAGTGTGTCCAGGCTGACAATGCTGAGCAGTGCATGCAGATG ATCCACAGGAACCAGGTACAAACTTTGTAACATGGAGCCTATAGGCTATA GAAGCATCTTATATGGGAGCAACATAGGCAAAATAAACAAATTTAACGGT TCTCAGTGGCAAATGTGCTAGATGTTGGCACATCGGCAACCAAATCCGCA GTGTGTTTTTTGGCACACAGTTTGACAGATTAGCCGAATAGGCTCGGTGG GCGTCACTCCACCGTCCGGGAAGGTAGTGTAAAGTGCCTTTCCCAAGGGC ATAACGTCGGGGCATGGTGAGTATCGAACTCGGGACTTATTGATTCTGAG TTCAACGCTCTAAACGTTACGCCACGCCGACGTCACTGACGTAGGCAAAA GAAACCAGATTTTTCCCCCAAGTATTCAAGAGTTATTGAGCTATTGTTTC TTTTACATCAATCTTGTCTTGACTTTGTCAATTTGTTTCGTAGTATTGGA CTATCTAGAATTGTCTTCATGTTATTTGCATATCAATTCATAGTTCGTGG TTAAAGCCTGACCGGCAAATCTTACTCAGTGTCACTGACGAAAAGTAGTG GATGCTACTTGAAACATCTAACCGTTTCCAAAATCATATTCAGTTGCTTG AGTAACTGGTAATTAGCATATCTTATAACCTGGATGTCTAACCTTCATCG ACGTATTCAAGAGTTAAATTTCAAAATCAGATCTTTAATGCTGGATATTA ACAGTTATTTCCCCTTCAAGGCTGATGTGATCACCCTGGATGGAGGAGAC ATCTACCAGGCTGGGATGAAGTACAACATGAGGCCCATCATGGGGGAGGA CTATGGAAACGGTATGTACAACCAGCTCTTGCTATTGTGTATGTTGCTGT ATTGAGGCTTGTGATTCTTGATCCAGCATTGTAAGATTTTGTATTTTGGC AACACTTCAGGGGCTAGCCTGCTAGTATGCTGTAGATATAACACTGTGAT TGAAGTTTTGTAATAAGTTGCACTCCCTTCACAGGTGATGCCAGCTACTG GGCTGTCGCTGTGGTCCGTAAGGACAACTCTGAAATCAACATCAACAACC TGCGTGGGCGTAAGTCCTGCCACACCGGTATCGGCAAGACGTCCGGCTGG ATCATCCCCACCGGCTGGCTGGTAGACCAGGACTTTGTTCACACCGATGG TCAGACTAGTCTGGTTCAGGCTGTGGGACACTTCTTCAGCCAGAGCTGTG TGCCTGGTCAGTATGTCATTCTTGTAGTCTTGGATTACTTCTTGTTAGCA GGATCTGTTTAGTCCAGAATGAGAACTTTTAAAGAAAAAGTTCTACACCT CTATATTAGTCATTATTGGCACTTAAATGTTAACTGCATGTAAATGTTTT CAGCTAGACGAACATTTGATATCTTGAAATGGTTTCCATCAAACCTTGTA GATTCGGCACTGAATATACCTCTATTTACACAAAGGTGCCAAGAGCCCTG AGTACGATCCCCAGAACACCAACCCCTCCAACCTGTGCTCCCTGTGTGCT GGTGCTGGAGAGGACCACTGTGTGAGGAACAAGAACGAGCCGTACTACGG ATATGCTGGGGCATTCAGGTATTCAGTCATTCTTTCAGTTATTTTACCAC CAGAACATAGCTCAAGTTCGTGATCTGTTTGTCAGGTGTTCCTTGATACA TACAGGCTCATGGTTTGATTTGCAAATATTTGAATGGATTTATGATGTTC ACATGATTATCGATAGTTTGCTAAACCTAATCTTGATATGTGGTTGTCCC CTCCAGGTGCCTTGCTGAGGGATCCGGTGATGTTGCCTTCATCAACCACC TGACCGTCCAGGACAACACTGATGGACACAACCCTGAGAACTGGGCCGCT GGCCTGCGCTCCAACGAGTTTGAGCTGCTGTGCACGGATGGTTCCCGCCG TCCCGTGGACCAGTGGCGCGAGTGCAGCCTGGCCCGTGTTCCGTCCCACG CTGTGATGACGTCCAACGACAGGAACCAGGAGTGGGTGGACAGGGCAGTG CAGCTGTTGAAGAACACTCAGGTGAGAAATCTGAAGAATCTGGGTAAAAT TGAGTACTGTAAATTCATTTACATTTGCGGTGGTTTTATGTTGCAGTTGG AGGGGTAAGAAGGTTTTGGCTGTGTTATAAATTCTCAGTTTAAACAATTC TACAGTAGAGTAGTCATAAAAAGGAGACATATTTACGGTGCCATGACTTT GCAGTACAGCGACCACTGCGAAAAACCACAAAATTAAACCACTGCAAAAG TTTCATGATTTACAGTGTATTGACCATATCCTCATCTGTGTATTGTAGAG CTGAAAGAAGGTGTTTTGAAAATCACCATTTCCATCCACAGGACATGTTT GGTACGGATGAGAACGAGCGTGGCTTCCAGATGTTTGACTCCGCCTCCTT CGGCGGCCACGACCTGCTGTTCCGTGATGACACCCATCATCTGGTGGAGG TGGGCAGCAAGGACAGCTGGGAGAAGTGGCTGGGACAGGAGTACCTGCGC TGTATCCGCAGTCACCATGCTGTGGAGCCAGTCCAGCCTCACAGTAAGAT CAAGTCTTTATTTCGAGCCAATGCTTTGAAAAATGCAAGCATTCTGTTGT TGAATCATTGTGAATTTTTTAATTTTCAAGTGCTCACAGAAAGTACTATT TTGTTGCACAGGCACCTTGCGCTGGTGCACCATCTCCAGCCAGGAGCAGC AGAAGTGCCAGGAGATGAGCCAGCATGTCAGCAGGAACCTGAACCACAGG CTGGAGTGTGTACAGGGCCAGTCTAGTGAGGACTGCATGTACAAGATCTC TCACCACCAGGTGAGGAACACAACAGTTTATATACATATTATGATACATC TTTTACAACAGAAAGCAGAATTAACTTCTAACATCCTGCAACGTACATTT ATCAGGCGCATGAAGAAAGCAGACATTTCAATGTCTACATTAAACAAATT TCATTTGGGAAGTTTTGTGTTATGAGGATCAGCGTTTAACAGTGCCAGTA ATAGAACAGTATAGGATGTATGTCTTACAGCAAAGATTCTTCTAGTGCCA ACACATGTGTTAGTGTTTAATAATGAACTGCGACCTCAATGACGTCATCG CATAAGGGTCATGTGACCCACCCGTCACTCCGTTCCATCGAGTCAGGCGG CCATGTCACAACATCCATGTTCCTAATAAACATCTGAAGTATCAGGTAAC ATCCCCGAGCAGAGTCACTCTTTTGCGCCTCTTGGCTACTTACTGACGTA GTTGCTTGTTAGTTTATGGTACTGGGATACGTAACTGTACTTCACATGTT TTCATCATTACATTTGGTTCAATCTTCAGGCTGATGTGATCACCCTGGAT GGGGGAGACATCTACACTGCCGGATCTGAGCACAACCTTGTGCCGGTCAT GGGAGAGGACTATGGAAATGGTGAGATGGAGGGAACGTAGTTTTCTGTTG TTCAAACCAGTACTTTTCATTTTAATGTTTGAAATCACTTGGAGACTTCA ATTGTTGATTTTTGTCCTTGGTGCTGAAAAAGTTGTTTTGTTGTATGCCA CTTGCAGGTGATGCCAGCTACTGGGCTGTCGCTGTGGTCCATAAGGACAA CCGTGATATCAACATCAACAACCTGCAGGGCCGTAAGTCCTGCCACACCG GTATCAGCAAGACCTCCGGCTGGAATGTGCCGGTCGGCTGGCTGATCCAG CACAACCAGATGCAGGTGGACAGCAGGAAGTCCATCCCACAGGCTGTGGG CAAGTTCTTCAGCAAGAGCTGTGTGCCTGGTCAGTGGAAACTTATTATTT GTTATCTAGTAGGTCAGGTAATTTTCTTTAGCACACTGAAGTAGGCATTT GGTTACCAATGTTCTATTTGTTACAGGGTTTGGCCCCAGAGAGAATGTTA AAAGACTAATTTTCACCAGAAATGACCTGAATAATGTGCCTTATCAACAG TTTTATAAAAATTGTCCTTTTAATAACTTAAAAGTAATTTCTAAAGTTTC CTTATTCTAGGGTTTGTGTAACAGTTTGACATCAAACACATTGCTTTCAT AATTCGCTCTTCAAAACCATTACAAAACTAAGCTAAGCTGTTCTTCCACT GCTAACCAGGTGCCCAGAGCCCAGAGTACAACCCTGATGGCACCAACCCT GAGAGCCTCTGTTCCCTGTGTGTCGGGGAGGGAGAAAACCGCTGTGTCCG CAACACCAACGAACCCTACTATGGATACTCTGGAGCATTCAGGTACTAAA AGGACCTTTGACAGGACTGTAACTGTTGAAATATGATATTCCATACACAT GTGTGATTTTCGAAAATGTCTGACCATTTTCTTCCGCCACTAGGTGTCTT GTTGAGGGTGCCGGTGATGTTGCCTTTGTGAACCATGTGACCGTGTATGA GAACACCAACGGCCACAGTGAGGAGGAATGGACCAGGAACCTAGATGAGG ACGACTTTGAACTTCTGTGTCCTGATGGCTCCAGGCAGCCATGGAACCAG TACAAGTATGAATCTTTCTTTACAAATTGGCAAAGAAAACATTAAAACGT CCTTTATATATATATCTGTTAGGACCTTGTCTGTAATCATGTAATCTGTA TCTGTAAACTATCTGACCCTTACCTCCTGATCTCAATAAGAAGTGGCCTG CAGGCTGTTCTGTGCTTCTCAATAATAAAAAAAAGGTTCAAGCAAACGAA CCTCCCATAGTACAAGTCCATCTACTTCTTAAAAAGAAATAATCTGTTTG CTTAGTTCATGAGTACCCTTGAGAACAATACCTCTTTGTTCTTTCACCAG GGAATGTAACTTGGCCCGTGTCCCGTCCCACTCTGTCATGACGTCTCCCC GTAGTAGGACAGACATTCAGCAGATTGTGGACTTCCTGAAACTTGCTCAG GTGAGACGAGCTAAAGCTTGCTATGTACTACATCTTGCTATCTACATTAT TTTCAAGACATTTATCCATTTCCAGAGCTACATACATGTAGCACCAGTGG TACTGGTCTGATATTCTCTCTTCTCCCCCATTTCAGGATCACTTTGGTTT CCAGTCCTACGGTGATTTTGAGATGTTTGACTCCAGCAAGTTCGGAGGTC GTGACCTGATGTTCCGTGACAACGTGCAGCGCCTGGTCCCGGTGGGGCAG CGGAACACGTGGCAGAAGTGGCTGGGCTCCAGCTACATGGAGTCTGTTGG TCACCTGATCAGCCATGATGAGCAGAGGAACCAGCATGTGCTTGGTACGT ACTGCTTATAGTCAATATTTCACCACATGATTCAGAACTAAGGTTGTAAC TTTTCATATTTTAGTTTCCCATGATAGTTCAACAAGGTATTTTGACACTG CAGCTCAATCATCAGAAATACTGGTAACTAGTCAACAGTAATTTTTTTGC TGCATTCATCCCTGTGTGCAGCAATTCTTTCATGACTTGTGAATGCTAGA TTCCACTAATAGTATTACCCGCTAGAAGTACAGGCAAACCTGCCCAAGAA GACCACTCAGGGGACCTATAAAATCTGGTCTGTGTAGACAGGTGGTCAAA AAATGGGAAAAATTATATAAGGGGCCACCAAAAAGTGGTCACATTGGCCT GGTGGTCCTTATGTAGATAGGTTCAGTGCATTGCCTGTAGGCTACTTGAT CAGTTCTACAAGAAGCAGGTAAGTTGTCAACAAGGCAATGCATTTTGAAT ATTTGCAGCATAATATGTAAATGACACCTGATACCTGAACTTCAGACAAA CAGGTGCGTTGGTGTGTGACGTCTGATGCTGAGAGGGAGAAGTGCGAGGA ACTGAGCCGTGTCCAGAAGGAGGGTGTGTCCTTCCCCACCGTCAAGTGCG TCCAGGCCGACAATGCTGATCAGTGCGGCCAGATGAT

Coding sequence (CDS) from alignment at Sc0000043:1263379..1270465-

>transcript:BL97205_cuf19 ID=transcript:BL97205_cuf19|Name=transcript:BL97205_cuf19|organism=Branchiostoma lanceolatum|type=CDS|length=1644bp|location=Sequence derived from alignment at Sc0000043:1263379..1270465- (Branchiostoma lanceolatum)
ATGACCTCCTACCACAGCAGGAAGAACCTGCAGCAGATTGTGGATGCCCT
CAACCAGGCACAGGAACATTTTGGCTCGGAGGGCTCTGGTGATTTCCAGA
TGTTTGACTCCAGCGAGTTCGAAGGTCGTGACCTGATGTTCCGTGACAAC
GTGCAGCGCCTGGTCCCGGTGGGGCAGCGGAACACGTGGCAGAAGTGGCT
GGGCTCCAGCTACATGGAGTCTGTTGGTCACCTGATCAGCCATGATGAGC
AGAGGAACCAGCATGTGCTTGACAAACAGGTGCGTTGGTGTGTGACGTCT
GATGCTGAGAGGGAGAAGTGCGAGGAACTGAGCCGTGTCCAGAAGGAGGG
TGTGTCCTTCCCCACCGTCAAGTGCGTCCAGGCCGACAATGCTGATCAGT
GCGGCCAGATGATGACCTCCTACCACAGCAGGAAGAACCTGCAGCAGATT
GTGGATGCCCTCAACCAGGCACAGGAACATTTTGGCTCGGAGGGCTCTGG
TGATTTCCAGATGTTTGACTCCAGCGAGTTCGAAGGTCGTGACCTGATGT
TCCGTGACAACGTGCAGCGCCTGGTCCCGGTGGGGCAGCGGAACACGTGG
CAGAAGTGGCTGGGCTCCAGCTACATGGAGTCTGTTGGTCACCTGATCAG
CCATGATGAGCAGAGGAACCAGCATGTGCTTGACAAACAGGTGCGTTGGT
GTGTGACGTCTGATGCTGAGAGGGAGAAGTGCGAGGAACTGAGCCGTGTC
CAGAAGGAGGGTGTGTCCTTCCCCACCGTCAAGTGCGTCCAGGCCGACAA
TGCTGATCAGTGCGGCCAGATGATGACCTCCTACCACAGCAGGAAGAACC
TGCAGCAGATTGTGGATGCCCTCAACCAGGCACAGGAACATTTTGGCTCG
GAGGGCTCTGGTGATTTCCAGATGTTTGACTCCAGCGAGTTCGAAGGTCG
TGACCTGATGTTCCGTGACAACGTGCAGCGCCTGGTCCCGGTGGGGCAGC
GGAACACGTGGCAGAAGTGGCTGGGCTCCAGCTACATGGAGTCTGTTGGT
CACCTGATCAGCCATGATGAGCAGAGGAACCAGCATGTGCTTGACAAACA
GGTGCGTTGGTGTGTGACGTCTGATGCTGAGAGGGAGAAGTGCGAGGAAC
TGAGCCGTGTCCAGAAGGAGGGTGTGTCCTTCCCCACCGTCAAGTGCGTC
CAGGCCGACAATGCTGATCAGTGCGGCCAGATGATGACCTCCTACCACAG
CAGGAAGAACCTGCAGCAGATTGTGGATGCCCTCAACCAGGCACAGGAAC
ATTTTGGCTCGGAGGGCTCTGGTGATTTCCAGATGTTTGACTCCAGCGAG
TTCGAAGGTCGTGACCTGATGTTCCGTGACAACGTGCAGCGCCTGGTCCC
GGTGGGGCAGCGGAACACGTGGCAGAAGTGGCTGGGCTCCAGCTACATGG
AGTCTGTTGGTCACCTGATCAGCCATGATGAGCAGAGGAACCAGCATGTG
CTTGACAAACAGGTGCGTTGGTGTGTGACGTCTGATGCTGAGAGGGAGAA
GTGCGAGGAACTGAGCCGTGTCCAGAAGGAGGGTGTGTCCTTCCCCACCG
TCAAGTGCGTCCAGGCCGACAATGCTGATCAGTGCGGCCAGATG
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97205gene:BL97205Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97205_cuf19transcript:BL97205_cuf19-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97205_cuf19-E1BL97205_cuf19-E1-1564476830-210105Branchiostoma lanceolatumexon
BL97205_cuf19-E2BL97205_cuf19-E2-1564476830-210103Branchiostoma lanceolatumexon
BL97205_cuf19-E3BL97205_cuf19-E3-1564476830-210101Branchiostoma lanceolatumexon
BL97205_cuf19-E4BL97205_cuf19-E4-1564476830-210099Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000043genomeSc0000043:1263379..1270465 -
Properties
Property NameValue
Transcript idBL97205_cuf19
Biotypeprotein_coding