Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00008819 ID=TCONS_00008819|Name=TCONS_00008819|organism=Clytia hemisphaerica|type=transcript|length=275bpRun BLAST on NCBI transcript from alignment at sc0000087:609664..609938 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00008819 ID=TCONS_00008819|Name=TCONS_00008819|organism=Clytia hemisphaerica|type=transcript|length=275bp|location=Sequence derived from alignment at sc0000087:609664..609938 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00008819 vs. Swiss-Prot (Human)
Match: CTHR1 (Collagen triple helix repeat-containing protein 1 OS=Homo sapiens GN=CTHRC1 PE=1 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 1.809e-20 Identity = 39/91 (42.86%), Postives = 60/91 (65.93%), Query Frame = 1 Query: 4 CCKRWFVTFDGHECA-PVPIDGIVYMHEGTG--NRYKNQHRPQVITGHCKISKSNIINVALNVGNCNGYGNVDAQTGWNSATRIQIEEVDE 267 CC+RW+ TF+G EC+ P+PI+ I+Y+ +G+ N N HR + G C+ + +++VA+ VG C+ Y DA TGWNS +RI IEE+ + Sbjct: 153 CCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK 243 The following BLAST results are available for this feature:
BLAST of TCONS_00008819 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|