Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00064680 ID=TCONS_00064680|Name=TCONS_00064680|organism=Clytia hemisphaerica|type=transcript|length=392bpRun BLAST on NCBI protein sequence of TCONS_00064680-protein >TCONS_00064680-protein ID=TCONS_00064680-protein|Name=TCONS_00064680-protein|organism=Clytia hemisphaerica|type=polypeptide|length=130bp ELSNKFFEWKFTPYPHFIMYDFEARVLPENIRPTEDLTYIQKQVAVSVAIRun BLAST on NCBI transcript from alignment at scaffold_420:124604..124995 Legend: exonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00064680 ID=TCONS_00064680|Name=TCONS_00064680|organism=Clytia hemisphaerica|type=transcript|length=392bp|location=Sequence derived from alignment at scaffold_420:124604..124995 (Clytia hemisphaerica) Coding sequence (CDS) from alignment at scaffold_420:124604..124995 >TCONS_00064680 ID=TCONS_00064680|Name=TCONS_00064680|organism=Clytia hemisphaerica|type=CDS|length=390bp|location=Sequence derived from alignment at scaffold_420:124604..124995 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
No biomaterial libraries express this feature.
Annotated Terms
The following terms have been associated with this transcript:
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00064680 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 0
|